KEGG   Pseudomonas putida H8234: L483_14060Help
Entry
L483_14060        CDS       T02706                                 

Definition
acetaldehyde dehydrogenase
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
pput  Pseudomonas putida H8234
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    L483_14060
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L483_14060
   00650 Butanoate metabolism
    L483_14060
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L483_14060
   00622 Xylene degradation
    L483_14060
   00621 Dioxin degradation
    L483_14060
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     L483_14060
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     L483_14060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2997555..2998484)
Genome map
AA seq 309 aa AA seqDB search
MSKKIKCALIGPGNIGTDLLYKLKRSEVLEPVWMVGIDATSEGLARAAALGLKTTSEGVD
GLLPHVMEDGIQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKHNLG
LGAMNVNMVTCGGQATIPLVAAVSSVQPVAYAEIIATAASKSVGPGTRKNIDEFTRTTAA
AVEQVGGAKKGKAIIIVNPAEPPLIMRDTVHCLTETEPDQAAITAAIADMIKQVQRYVPG
YKLVNGPVFDGNRVSIFMEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEAMLKGELTLR
ASSPQPAIA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagataaaatgcgccctcatcgggcccggcaacatcggtaccgacctgctg
tacaagctcaagcgcagtgaagtactggagcccgtctggatggtgggtatcgacgccacc
tccgaaggcctggcccgcgccgccgcgctgggcctgaagaccaccagcgagggcgtcgac
ggcctgctaccgcatgtaatggaagacggcatccagatcgccttcgatgctacctccgcg
tatgtgcatgccgaaaacagccgcaagctcaatgccttgggtgtgctgatgatcgacctg
acgccagcagccatcggcccctactgcgtgccaccggtcaatctcaagcacaacctaggc
ctgggcgcgatgaacgtcaacatggtgacctgtggcggccaggcgaccatcccgctggtg
gccgcggtgtccagcgtgcagccggtggcctatgccgagatcattgccacggcggcctcg
aaatcggtcggcccaggcacacgcaagaacatcgatgaattcacccgtaccaccgctgcg
gccgtggaacaggttggcggcgcaaaaaagggcaaggcaatcattatcgtcaaccccgcc
gagccgccgctgatcatgcgtgacaccgtgcactgcctgaccgaaaccgagcctgaccag
gcagccatcaccgccgcgattgccgacatgatcaagcaagtccagcgctatgtgcccggc
tacaagctggtcaacggcccggtgttcgacggtaaccgggtgtcgattttcatggaagtc
gaaggcctgggcgactatctgcccaaatatgccggcaacctcgacatcatgaccgccgcc
gccgcgcgcaccgccgagatgtttgccgaagcgatgctcaaaggcgagctgaccctgcgt
gccagcagcccacaacctgccatcgcctaa

DBGET integrated database retrieval system