KEGG   Pseudomonas putida H8234: L483_15070Help
Entry
L483_15070        CDS       T02706                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pput  Pseudomonas putida H8234
Brite
Enzymes [BR:pput01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     L483_15070
Secretion system [BR:pput02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   L483_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3209226..3210023
Genome map
AA seq 265 aa AA seqDB search
MKKLAVAIALASCSLAAFAQAPAPAAEAAQAPAAAAPAAVAAPAAAADIEIMTVINTLKS
KYPSTNFTNVERAPIDGIYEITMGKNIAYTDSSGRYLMFGSIYDMQTRKDLTAPKRAAAE
KIDVSKFPLADAFTRVKGDGSRKLYLFSDPDCPYCKKLETEVLSKLDNVTIYTFMYPLES
LHPQARAKAESVWCLPEAGRAAAWEALAQGTQPPAKNCDNPIERNIALAESIGFQGTPAM
VSEDGRKMPGLVSAERLEAWLNGGS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctcgctgttgctatcgctctcgccagttgctcgctggctgcattcgcccag
gcccctgcgcccgcagcagaggcggctcaggcccctgcagcagccgctccagcagccgtt
gcagcgccagcagctgccgctgacatcgagatcatgaccgtgatcaacacgctcaagagc
aaatacccctccaccaacttcaccaacgtggagcgagcgccgatcgacggcatctacgag
atcaccatgggcaagaacattgcctacaccgattcctccggtcgctacctgatgttcggc
agcatctacgacatgcagacccgcaaggacctgacggcgcccaagcgtgctgccgccgaa
aaaatcgacgtctcgaagtttccgctggccgatgcgttcacccgcgtgaagggcgatggc
tcccggaagctctacctgttctccgacccggattgcccgtactgcaagaagctggaaacc
gaggtcctcagcaagttggacaacgtgaccatttacaccttcatgtatccgctggagtcg
ctgcacccgcaggctcgtgccaaagctgagtcggtctggtgcctgcctgaagctggccgt
gctgctgcatgggaagcgttggcgcaagggacccagccgccagcgaagaattgcgacaac
ccaatcgagcgcaacatcgcgctggccgaaagcatcggcttccagggcacccctgcgatg
gtgagcgaagacgggcggaaaatgccgggcctggtatcggccgaacgtctggaagcctgg
ctcaacggcggctcctga

DBGET integrated database retrieval system