KEGG   Pseudomonas putida H8234: L483_20065Help
Entry
L483_20065        CDS       T02706                                 

Definition
(GenBank) hypothetical protein
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00260  Glycine, serine and threonine metabolism
pput00330  Arginine and proline metabolism
pput00340  Histidine metabolism
pput00350  Tyrosine metabolism
pput00360  Phenylalanine metabolism
pput00380  Tryptophan metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L483_20065
   00330 Arginine and proline metabolism
    L483_20065
   00340 Histidine metabolism
    L483_20065
   00350 Tyrosine metabolism
    L483_20065
   00360 Phenylalanine metabolism
    L483_20065
   00380 Tryptophan metabolism
    L483_20065
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     L483_20065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Thi4 FAD_binding_2 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox Pyr_redox_3 GIDA AlaDh_PNT_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AGN82794
UniProt: R9VCS1
Position
4256295..4257875
Genome map
AA seq 526 aa AA seqDB search
MGLTRRDLIAHLMAAGSYGAALGSLSALGLLPAAATASTFQPLGLPTTSGNGKRVLVVGA
GISGLVAAYELGKAGFDVRVLEARERIGGRAWTLRNGDEVLHNDGSRQQVRFDNGHYFNA
GPARLPSHHLTILGYCRELGVPLEVLVNSSRNALAQPDLAQPPLLLRQAVNDTRGHLSEL
LSRSISGKALDKELDTGDQKALLDFLKVYGDLDEQRHYKGSVRAGYTRFAGAGDQTPIQR
QPVALKQLLNPNLMLPLVFDEIPEFSATMFQPVGGMDQIAKALYAKVQDKVQLHAEVQAI
RTGDNGSQVTWRDRRSGKSQVETADYAIVTIPLPLLARVDHNFGKTTQAAIAQAKPDLAN
KVAWQAPRFWESEFQIYGGLSYINHEARLLWYPSDHLNSAQGILVGTYNTGEVARTFATR
STEQQLAASRQAVESLHPGHAGKLQRGVAVNWSKVPFSESPWIVHDVLAEPGYSHLNQPQ
GRTWLASDALAHGGVGIWQNSAADSARHVVGQIARHALQQQRGVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgacccgtagagaccttattgcccacctgatggccgctggcagctacggcgcc
gcgcttggcagcctgtccgcgctgggcctgttgcccgcagcagccacggccagcaccttc
cagccgctgggcctgccgaccacgtccggcaacggcaagcgcgtgctggtggtgggggct
ggcatcagcggcctggtggcagcctatgaacttggcaaagccggttttgacgtgcgcgtg
ctggaagcccgcgagcgaatcggcgggcgtgcctggacgctgcgcaacggtgacgaggtc
ctgcacaatgacggcagccgccagcaggtgcggttcgacaacggccactatttcaatgca
gggcccgcacgcctgcccagccatcacctgaccatcctcggctactgccgcgagctgggc
gtgccgctggaagtgctggtcaacagcagccgcaacgccctcgcccaaccggaccttgcg
cagccaccgttactgctgcgccaggcggtgaatgacacccgtggacacctcagcgaactg
ctgtcgcgcagcatcagcggcaaagcgctggacaaggagctggacacgggcgatcagaag
gccttgctggattttctcaaggtatacggtgacctcgacgagcagcgtcattacaagggc
tcggttcgcgccggctacacccgcttcgccggggcgggcgaccagacaccgatccagcgc
cagccagtggcactcaagcaactgctcaaccctaacctgatgctgccgctggtgttcgac
gagatcccggagttttccgccaccatgttccagccggtcggcggcatggaccagattgcc
aaggccctgtacgccaaggtgcaggacaaggtgcaactgcatgccgaagtgcaggcgatc
cgcaccggagacaacggtagccaggttacctggcgtgaccggcgcagcggcaagtcccaa
gtggaaaccgccgactacgccatcgtcaccatccccctgccactgctggcccgggttgac
cacaactttggcaaaaccacccaggcggccatcgcccaggccaagccggacctggccaac
aaggtggcctggcaggcaccccggttttgggaaagcgagttccagatctatggcgggctc
tcctatatcaaccacgaagcgcggctgctgtggtaccccagcgatcacctgaacagtgcc
cagggcatcctggtgggcacctacaacaccggcgaagtggcgcgcacatttgccacgcgc
tcgacagagcagcaactggcagcgtcgcgccaggccgtggagtcgctgcacccgggccac
gccggcaagttgcagcgtggggtggcggtcaactggtccaaggtaccgttcagcgaaagc
ccgtggattgtccatgacgtgcttgccgagcccggttattcgcacctcaaccagccccaa
ggccgcacctggctggccagcgatgcactggcccatggcggggtgggtatctggcagaac
agtgctgcggactcggcccgccatgtggtcgggcagatcgcccggcacgccctgcaacag
caacgcggcgtcgccgcctga

DBGET integrated database retrieval system