KEGG   Pseudomonas putida H8234: L483_21220Help
Entry
L483_21220        CDS       T02706                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pput  Pseudomonas putida H8234
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L483_21220
Enzymes [BR:pput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     L483_21220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4448756..4449664)
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVARAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPGVSSGVALITVDAASQNCIVIIPGGNGLLTP
HSVQRFDALLQAAEVVICQLEVPADTVAWTLVRARELGKQVILNPAPATGPLPAGWFACI
DYLTPNESEAEALTSVAVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APVVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtagtcggcagcctcaatatggacctggtggctcgcgcccag
cgcctgccccgggccggcgaaacactccccggcgatagctttttcaccgtgccgggcggc
aagggcgccaaccaggccgtggcggtggcacggctgggcggtagcgtggcaatgatcggc
aatgtgggtgacgatgactatggccggcaactgcatcgggccctttatgtcgagggcatc
gattgccagggcgtcagcacgtgcccaggggtatccagcggtgtggcactgattaccgtg
gatgctgccagccagaactgcattgtcatcattcctggcggcaacggcctgctgacgccg
cactcggtacagcgcttcgatgcgctgctgcaggcagccgaggtggtcatctgccaactg
gaagtgccggccgacaccgtggcctggaccctggtcagggcccgtgaactgggcaagcag
gtgatcctgaacccggcgccggccaccgggcccttgccggcgggctggtttgcctgcatc
gattacctcacacctaacgaaagcgaggccgaagccctgaccagcgtggctgttacggac
caggacagtgcgcggcgtgctggcgagcgcttgctgcaactgggggcgggtaaagtgatc
atcaccctgggcgcgcaaggggccttgctggtgactgcccaaggtcatcagcactacccg
gcgccggtggtgcagccgctggacaccaccgctgctggtgatactttcatcggtggcttt
gctgccgggctggtgcgggggctggaggagggcgaagccattgcctttggccagcgtgcc
gcagccttgtcggttacccgtgctggcgcccagccgtcgatcccttacctggcggagctg
acaccatga

DBGET integrated database retrieval system