KEGG   Pseudomonas putida H8234: L483_22630Help
Entry
L483_22630        CDS       T02706                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pput  Pseudomonas putida H8234
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pput00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4724723..4726789
Genome map
AA seq 688 aa AA seqDB search
MSETALHRLANRVGLSRDWIDANARPQRVSDEVLCKLLAGLGHPASDDTAIAASLRAVEA
AEDSEHLPPLLTADQGQPLALSRYFSAASVARCTLEDQSSVTLSLDEQARLPGDLPIGYH
QVEIDSRRFTVAVAPPRCYSLADNVQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLAR
LAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYASPAALLGEREVRMAIEAC
GLEQQLEELEQRPLVDWPRAASARLRLLEALYHGFSHGDHPLRRDFDSFREAGGQALEHH
CRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVAAFANAYPAKVEFHAFCQWLTERGLQ
RAQEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLTVGAPPDILNRAGQDWGIC
AFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPLD
DLLRLLALESVRHQAVILGEDLGTVPDGLRETLAEKAVLGMRVLPFEQTQPGQFKPILDW
PDSALATTGTHDLAPLAGWLENRDIDWSHRLQLIDAATELHWRQDRQKEHDGLRRTLEAN
YGELKDNDAVIDAAIRFVGHTRAPLVLVPLEDLLGCEEQPNLPGTTAGHPNWRRRFTQPV
AELLDDEDAARRLELLAQAREQAWERDR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgcttggcaaaccgcgtcgggttaagccgcgactggatc
gacgccaatgcccggccccagcgcgtcagcgacgaggtgctgtgcaagctactcgcaggc
cttggccacccggccagcgatgacacggccattgccgccagcctgcgcgcggtagaagcc
gccgaagacagcgaacatttgccgcccttgctgaccgccgaccaaggccagccattggcg
ctgtcacgctatttcagcgctgccagcgtcgcccgctgcaccttggaagaccaatcctcg
gttaccctcagcctggacgagcaggcacgcctgccaggtgacctgcccattggctaccac
caggtggaaatagacagccgccgcttcaccgtggccgtggccccgccgcgctgctacagc
cttgcagacaacgtgcagccccccccacgctgctggggcctggcagtgcagctgtacagc
ctgcgcaggcccggcgatggcggttacggcgactgcctggcgctggagcagctggcccgc
ctggccgccgagcgcggtgccgatgccttggccatcagccccattcatgcactgtcggcc
atcgaccaagagcactacagcccctactcaccctccagccgcctgctgctcaacaccctg
tatgccagccccgcagccctgctgggtgagcgggaggtgcgcatggccattgaagcctgc
ggactggagcaacaactggaagagctggagcaacgcccactggttgattggccacgcgcc
gccagtgcccgcctgcgcttgcttgaagcgctgtaccacgggttcagccatggcgaccat
ccgctgcgcagggatttcgatagcttccgcgaggccggtggccaggccctggagcaccac
tgccgcttcgaggtgttgcaggcacaggctgtagagcacggcctgggcgccgactggcgc
aactggccaaaggcctggcacgacccctatcacccggaagtggcggccttcgccaatgct
tacccggccaaggtcgagttccatgccttttgccaatggctgaccgaacgcggcctgcaa
cgtgctcaggaggcagcccgcggcaacggtatggctgtgggcttgatcgccgacctggcg
gtgggtgccgacggtgccggcagccaggcatggagccgccaggatgaattgctggccggc
ctgaccgtgggtgcgccgcccgacatcctcaaccgcgccggccaggattggggcatctgc
gccttctcgcccgagggcctcaagcgtaatggctaccgcgcctttatcgagatgctgcgg
gcgaacctggcacatgccggcggcctgcgcatcgaccatgtgatgggcctgcgccggctg
tggctgatcccgcagggagccaagcccagcgaaggcgcctacctcaattacccgctggac
gacctgttgcgcctgctggcgctggagtcggtgcgccaccaggcagtcatccttggcgaa
gacctgggcaccgtgcccgacggcctgcgcgaaacacttgccgagaaagcagtgctgggc
atgcgcgtgctgcccttcgaacagacccagccaggccagttcaagcccattctggactgg
ccagacagcgcccttgccacaaccggcacccacgacctggccccgctggccggctggctg
gaaaaccgcgacatcgactggagccaccgcttgcaactgatcgacgctgccaccgaactg
cattggcgccaagaccgccagaaagaacacgacggcctgcgccgcaccctggaggccaac
tacggcgaactgaaggacaacgacgcggtgatcgacgcggccatccgcttcgttggccac
acccgtgcgcccttggtgctggtaccgctcgaagacctgttgggctgcgaagagcagccg
aacctgccaggcactacagccgggcaccctaactggaggcggcgcttcacccaaccggtg
gcagaactgctcgatgacgaagatgccgcacggcgcctggagctgctggcccaggcccgc
gaacaggcctgggagcgtgaccgatga

DBGET integrated database retrieval system