KEGG   Pseudomonas putida H8234: L483_22660Help
Entry
L483_22660        CDS       T02706                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pput  Pseudomonas putida H8234
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L483_22660
Enzymes [BR:pput01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     L483_22660
Exosome [BR:pput04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L483_22660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4734186..4736396)
Genome map
AA seq 736 aa AA seqDB search
MNATTRENGGLRQRDLDALARAEHADPFAVLGPHGDGKGGVFIRAFLPNALNARVLARDD
GRVLAEMVQGAVPGLFTAHLDDAQAYLLHIGWAGGEQITEDPYSFGPQLGDMDLHLFAEG
NHRDLSGRFGAQPIQVDGIDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHGAGVWE
LFVPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHAWQDHDWMAQ
RAQRHGYNAPLSIYELHPGSWRCELDEAGEVGRYYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRYGGRENLEAIDFIRHLNGVAAVEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRAHHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWDHDSELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVTSEAVASHGQPLS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaccacgcgtgaaaacggcggccttcggcaacgggacctggatgccctggcc
cgcgccgaacacgccgatccttttgcagtactcggcccccatggcgatggcaagggcggt
gtgtttatccgcgccttcctgcccaatgccctgaatgcacgggtgctggcgcgcgatgat
gggcgcgtgctggctgaaatggtgcaaggtgcagttccgggattgttcacggcgcacctg
gatgatgcgcaggcctatctgctgcacatcggctgggccggcggcgagcaaatcaccgaa
gacccttacagctttggcccgcaattgggcgacatggacttgcacctgttcgccgagggc
aaccaccgcgacttgtccgggcgctttggtgcccagccgatccaggtcgatggcatcgat
ggcgtgtgtttctcggtgtgggcgccgaatgcccggcgggtatcggtggtgggtgatttc
aacaactgggacggccgccgccaccccatgcgcctgcgccacggcgcgggggtgtgggag
ctgttcgtgccgcgcctgggcgtgggcgaaacctacaagttcgaggtgctgggcaaggac
gggatactgccactcaaagcagacccgctggcccgcgctaccgaattgccgcccagcacc
gcgtccaaggtggccggtgagctcagccatgcgtggcaggaccacgactggatggcacaa
cgcgcccagcgccatggttacaatgcccccctgtcgatttacgaactgcacccggggtca
tggcgctgcgagctggacgaggcaggcgaagtcgggcgctactacaactggcgcgagctg
gccgagcggctggtgccctacgtgcaggagctgggctttactcatatcgagttgctaccg
atcatggagcacccgtttggcggttcgtggggctatcagccactgtcgatgttcgcgccc
acctcgcgctacggcagtgccgaggactttgccgcgttcatcgatgcctgccaccaaggc
ggcataggcgtgctcctggactgggtgccggcgcatttccccaccgacgaacacggcctg
gcccgcttcgacggcaccgcgctgtacgaatacgacaaccccctggagggctaccaccag
gactggaacacgctgatctacaacctgggccgcaacgaagtgcgcggcttcatgatggcc
tcggcgctgcactggttgaagcacttccacattgacggcctgcgggtcgatgcggtggcc
tcgatgctgtaccgcgactactcgcgcaaggctggcgaatgggtgcctaaccgctacggc
gggcgcgagaacctggaggctatcgacttcattcgccacctcaacggcgtggctgccgtc
gaggcccctggtgccctcatcattgccgaagaatccaccgcctggcccggcgtcagccag
ccgacccagcagggcggcctgggctttgcctacaagtggaacatgggctggatgcacgac
accctgcattacatccagaacgacccggtgcatcgcgcccaccaccacaacgagatgagt
ttcgggctgatctatgcctattccgagcatttcatcctgcccatctcccatgacgaagtg
gtgcatggcaagcactcgctgatcgacaagatgcccggcgaccgctggcagaaatttgcc
aacttgcgtgcctacctcaccttcatgtgggcgcaccctggcaagaagttgctgttcatg
ggttgcgagttcggccagtggcgtgagtgggaccatgacagcgaactggactggtacctg
ttgcagtaccccgagcaccaaggtgtgcaacgcctggtgggcgacctcaatcgcctgtac
cgtgaggtgccggcgctgcacgagcaggattgccagccgcagggcttccagtggctgatc
ggggacgacgcgcaaaacagcgtgtacgcctggctgcgctggagcagcagtggcgagccg
gtgctggtggtggccaacttcaccccggtgccgcgtgagggctaccgcattggcgtgccg
tttggcgagcgctggcaggagctgctgaacagcgatgccgagctgtatgcagggtccaac
gtgggcaacttgggcgctgtaaccagtgaggcagtggccagccatgggcagccattgtcg
ctggccctaaatttgccgccgcttggcgtgttgataatgaaaccggcctga

DBGET integrated database retrieval system