KEGG   Pseudomonas putida H8234: L483_27080Help
Entry
L483_27080        CDS       T02706                                 

Definition
iron-sulfur protein
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
pput  Pseudomonas putida H8234
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    L483_27080
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L483_27080
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     L483_27080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5738967..5739560)
Genome map
AA seq 197 aa AA seqDB search
MSNDGVNAGRRRFLVAATSVVGAAGAVGAAVPFVGSWFPSAKAKAAGAPVKVNIAKVEAG
QQMVAEWRGQPVFIVRRTEEILGNLKKITGDLSDPESKASVQPTYVDPEVRSIKPEILIL
VGLCTHLGCSPTFRPEVAPADLGPKWVGGYFCPCHGSHYDLAGRVYKSQPAPLNLPVPPH
SYESDDIIVIGVDQENA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacggcgtcaacgcaggccggcgccgcttcctcgtagccgcgacatccgtg
gtcggggcagcgggagcagtgggggctgcggtaccgttcgtggggtcatggtttcccagt
gccaaggcgaaagccgcgggtgcaccggtgaaggtcaatattgccaaggtcgaggccggg
cagcagatggtggctgagtggcgtggccagccggtgttcatcgtgcgccgaacggaagaa
atccttggcaacctgaaaaaaattacgggtgacctgtctgatccagagtccaaggcttcg
gtgcagccgacctacgtcgaccctgaggttcgctcgatcaagccggaaatcctcattctc
gtcggcctgtgcacgcacctgggctgctcgcccaccttccgcccggaagttgcgcctgct
gaccttggtccgaaatgggtgggtggctatttctgcccgtgccacggctcccactacgac
ctggccggccgtgtctacaagtcgcagccggcacctctcaacctgccagtgccgccgcac
tcttacgagtcggacgatatcatcgtcatcggcgtcgaccaggagaacgcatga

DBGET integrated database retrieval system