KEGG   Pseudomonas sp. UW4: PputUW4_00076Help
Entry
PputUW4_00076     CDS       T02357                                 

Gene name
pleD
Definition
diguanylate cyclase (EC:2.7.7.65)
Orthology
K13590  
diguanylate cyclase
Organism
ppuu  Pseudomonas sp. UW4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77150..79129
Genome map
AA seq 659 aa AA seqDB search
MSDEAQRWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTDDMDAGLAALIPRLEKAVLDSEQRRETRINQTSAALTALVTQLQTLPLPRDVSRPL
KSFARQLDARVSQAREMPLLLSELSGLQGKALSQLETPTEPGRPGLLQRLFGGREAEEAV
ASTTASPAPAAPDAIETVICEVPMAERVEEASAPAEPAEASPAPAVVALAPAAAEPQSAS
AGAAETGSTEKPTPETIETPLESQVNPDELIVPASPDGQALLATPTEEVVAADQSLSGHD
TFYALPDTPEPSYSSVASHIEHTLLGLLEDLTLPERHRPQAESMRDRLKNGLNWYELLPI
LDDFATLMLAITDSGQHEFEAYLQRLNERLESFQSNLQAATAGHADNRSAARQMDTQIRE
QVDGLQSSMQEAADLEGLKHVLENHLEGLLGTMDQHQKQRDEREQEVAARLHSLAERVAH
MEQEAQGYREHLEEQRQKALVDPLTGLPNRAAWSERLEHEVKQWQQHGNTLLLAMLDLDH
FKRINDNYGHLAGDKVLKIIASVLRKRLRATDFIARFGGEEFVLLMPSTVPAAGLKLLES
LRASIEACPFHFKGEPVTITVSVGMSAFRPGEHSDQVLKRADQALYRAKNAGRNRVEPG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagcacagcgctggaaagagaaatacctcaaaagcatcgaacaacaggaa
aagctcgaacgtcgctgggacgcgcggctcgacttgctgcgccgtggacttgtgcgcagc
accctggcggcggaaggtactgaccgcgcggttgaccaatgcatgaaggaaatgcgcgag
gtcgtgcgtaccgacgacatggacgccggcctggccgcgctgattccacgcctggaaaaa
gccgtgctcgactccgagcagcgtcgggaaacccggatcaaccagaccagtgccgccctg
actgcactggtcactcaactgcaaacattgccgctgcctcgggatgtgagccggccactc
aagagtttcgccaggcaactggatgcgcgggtcagtcaggcgcgtgagatgcccttgttg
ctcagcgagctgagtggcttgcaaggcaaggccctgagccagctggagaccccgacggaa
cctggtcggccgggcttgttgcagcgattgttcggcggtcgtgaagcggaagaagcggtg
gcatcaacgactgcttctcctgcgccagcggccccggacgcgattgagacggtaatttgc
gaagtgcccatggctgagcgagttgaagaggcgtccgcgccggccgagccagccgaggcc
tcccctgctccggcagtcgtggccctggcacctgcggctgcggagcctcaatccgccagt
gcaggcgcggcagaaaccgggtcgaccgagaagccgaccccggaaaccatcgaaacacct
cttgagtcgcaagtgaaccccgacgagctgatcgtgccagcatcgccggatggccaggcc
ttgcttgcgactccgacagaggaggtggtcgccgcagatcagtctctatccggtcacgac
acgttctatgcactcccggataccccagagccctcctacagctcggtggccagccacatc
gaacacacgctgctggggctgctcgaagacctgacattgcccgagcgtcatcgcccgcaa
gccgaatccatgcgcgatcgtctgaaaaacgggttgaactggtacgaattactaccgatt
ctcgacgacttcgccacgttgatgctggccattaccgacagcggccagcatgagttcgaa
gcctacctgcaacgattgaacgagcgcctcgaatcgttccagagcaacttgcaggccgcc
accgcagggcacgccgacaaccgttcggctgcgcggcagatggacacgcagatccgcgaa
caggttgatggcttgcaaagcagcatgcaggaagccgcggacctggaaggtctcaaacac
gttctggaaaaccatctcgaaggcttgctgggcaccatggaccagcaccagaaacaacgc
gatgagcgcgagcaagaggtcgctgcgcgcctgcacagcctggccgagcgcgtcgcccat
atggagcaggaggcccagggttaccgtgagcatcttgaagagcaacggcagaaggcattg
gtcgacccgttgaccggcctgcccaaccgcgcggcctggagcgagcgcctggagcatgaa
gtcaaacaatggcagcaacatggcaatacgctgttactggccatgctcgacctcgatcat
ttcaagcgcatcaacgataactacgggcatctggccggtgacaaagtgctgaagatcatt
gccagcgtgttgcgcaagcgtcttcgcgcaacggacttcattgcccggttcggcggcgag
gagtttgtgctgttgatgccatccacagtgccggcggcgggactgaagttgctggaaagc
ctgcgtgcctccatcgaggcctgtccgttccacttcaagggagagccggtgaccattacc
gtgtctgtcggaatgtcggcgttcaggccgggtgagcacagcgatcaagtgcttaaaaga
gccgatcaggcgttgtaccgtgcaaaaaatgccggacgcaaccgcgtggagccgggctga

DBGET integrated database retrieval system