KEGG   Pseudomonas sp. UW4: PputUW4_00147Help
Entry
PputUW4_00147     CDS       T02357                                 

Gene name
gabT1
Definition
4-aminobutyrate transaminase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputUW4_00147 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputUW4_00147 (gabT1)
   00310 Lysine degradation
    PputUW4_00147 (gabT1)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PputUW4_00147 (gabT1)
    2.6.1.48  5-aminovalerate transaminase
     PputUW4_00147 (gabT1)
Amino acid related enzymes [BR:ppuu01007]
 Aminotransferase (transaminase)
  Class III
   PputUW4_00147 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165674..166951
Genome map
AA seq 425 aa AA seqDB search
MSKTNASLMARRTNAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVEVCEKINAKVPGDFAKKTLLVTTGSEAVENSI
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL
FENGDSHKPNAAAVASVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEE
CFAEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgcttctttgatggcccgccgtaccaatgcagttccacgtggtgtt
ggccagattcacccgatcttcgccgagtccgcgaagaacgcgaccgtgaccgacgttgaa
ggtcgtgagttcatcgacttcgccggcggtatcgccgtgctgaacaccggccacgtgcac
ccgaaaatcatcgcggccgtgaccgagcagctgaacaagctgacccacacgtgcttccag
gtgctggcctacgagccgtacgtagaagtgtgcgaaaaaatcaacgccaaggtgccaggc
gatttcgccaagaaaaccctgttggtgaccaccggttccgaagccgtggaaaactcgatc
aagatcgcccgtgccgccactggccgtgccggcgtgatcgcgttcaccggcgcttaccac
ggtcgcaccatgatgaccctgggcctgaccggtaaagtcgtgccttactcggccggcatg
ggcctgatgccaggcggcatcttccgcgcgctgtacccgaacgaactgcacggtgtgagc
atcgacgactcgatcgcttccatcgaacgcatcttcaagaacgacgccgagccgaaagac
atcgctgcgatcatcatcgagccggttcagggtgaaggtggtttctacgtcgctccgaaa
gaattcatgaagcgtctgcgtgccctgtgcgaccagcacggcatcctgctgatcgctgac
gaagtacagactggcgctggccgtaccggtactttcttcgccatggaacagatgggcgtt
gctgccgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgagtacatggacgccatcgctccaggcggcctgggcggcacctacgcc
ggtagcccgatcgcttgcgccgcggccctggccgtgatggaagtgttcgaagaagagcac
ctgctggatcgttgcaaggccgttggcgagcgtctggtaaccggcctgaaggccatccag
gccaaatacccggtgatcggcgaagtccgtgccctgggtgcgatgatcgctgtcgagctg
ttcgaaaacggcgacagccacaagccaaacgccgccgctgtggcatcggttgtggccaag
gctcgcgacaagggcctgatcctgctgtcctgcggcacctacggcaacgttctgcgcgtc
ctggtaccgctgacctcgccggacgagcaactggacaaaggcctggcgatcatcgaagag
tgcttcgccgagctgtaa

DBGET integrated database retrieval system