KEGG   Pseudomonas sp. UW4: PputUW4_00147Help
Entry
PputUW4_00147     CDS       T02357                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00250  Alanine, aspartate and glutamate metabolism
ppuu00310  Lysine degradation
ppuu00650  Butanoate metabolism
ppuu01100  Metabolic pathways
ppuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputUW4_00147 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputUW4_00147 (gabT1)
   00310 Lysine degradation
    PputUW4_00147 (gabT1)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PputUW4_00147 (gabT1)
    2.6.1.48  5-aminovalerate transaminase
     PputUW4_00147 (gabT1)
Amino acid related enzymes [BR:ppuu01007]
 Aminotransferase (transaminase)
  Class III
   PputUW4_00147 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFY17355
UniProt: K9NDR2
Position
165674..166951
Genome map
AA seq 425 aa AA seqDB search
MSKTNASLMARRTNAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVEVCEKINAKVPGDFAKKTLLVTTGSEAVENSI
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL
FENGDSHKPNAAAVASVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEE
CFAEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgcttctttgatggcccgccgtaccaatgcagttccacgtggtgtt
ggccagattcacccgatcttcgccgagtccgcgaagaacgcgaccgtgaccgacgttgaa
ggtcgtgagttcatcgacttcgccggcggtatcgccgtgctgaacaccggccacgtgcac
ccgaaaatcatcgcggccgtgaccgagcagctgaacaagctgacccacacgtgcttccag
gtgctggcctacgagccgtacgtagaagtgtgcgaaaaaatcaacgccaaggtgccaggc
gatttcgccaagaaaaccctgttggtgaccaccggttccgaagccgtggaaaactcgatc
aagatcgcccgtgccgccactggccgtgccggcgtgatcgcgttcaccggcgcttaccac
ggtcgcaccatgatgaccctgggcctgaccggtaaagtcgtgccttactcggccggcatg
ggcctgatgccaggcggcatcttccgcgcgctgtacccgaacgaactgcacggtgtgagc
atcgacgactcgatcgcttccatcgaacgcatcttcaagaacgacgccgagccgaaagac
atcgctgcgatcatcatcgagccggttcagggtgaaggtggtttctacgtcgctccgaaa
gaattcatgaagcgtctgcgtgccctgtgcgaccagcacggcatcctgctgatcgctgac
gaagtacagactggcgctggccgtaccggtactttcttcgccatggaacagatgggcgtt
gctgccgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgagtacatggacgccatcgctccaggcggcctgggcggcacctacgcc
ggtagcccgatcgcttgcgccgcggccctggccgtgatggaagtgttcgaagaagagcac
ctgctggatcgttgcaaggccgttggcgagcgtctggtaaccggcctgaaggccatccag
gccaaatacccggtgatcggcgaagtccgtgccctgggtgcgatgatcgctgtcgagctg
ttcgaaaacggcgacagccacaagccaaacgccgccgctgtggcatcggttgtggccaag
gctcgcgacaagggcctgatcctgctgtcctgcggcacctacggcaacgttctgcgcgtc
ctggtaccgctgacctcgccggacgagcaactggacaaaggcctggcgatcatcgaagag
tgcttcgccgagctgtaa

DBGET integrated database retrieval system