KEGG   Pseudomonas sp. UW4: PputUW4_00394Help
Entry
PputUW4_00394     CDS       T02357                                 

Gene name
aceF1
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00010  Glycolysis / Gluconeogenesis
ppuu00020  Citrate cycle (TCA cycle)
ppuu00620  Pyruvate metabolism
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
ppuu01200  Carbon metabolism
Module
ppuu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputUW4_00394 (aceF1)
   00020 Citrate cycle (TCA cycle)
    PputUW4_00394 (aceF1)
   00620 Pyruvate metabolism
    PputUW4_00394 (aceF1)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PputUW4_00394 (aceF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 NQRA HlyD_3 DUF2254 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AFY17602
UniProt: K9NDB5
Position
complement(448053..450008)
Genome map
AA seq 651 aa AA seqDB search
MSELIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEVPAPKAGIIKSLKVK
LGDRLKEGDELLELEVEGAAAAAPAAAVAPAAKAEAKPAAAPAAAAPAAAPAAASVQQVH
VPDIGSSGKAQIIEIQVKVGDTVAADQSLITLESDKASMEIPSPAAGVVKAISVKLNDEV
GTGDLILDLEVAGAAAPAAAPAQAAAPAAAAAPAPAAAPAAPVADSVQDIHVPDIGSAGK
AKIIEVLVKAGDTVVADQSLITLESDKASMEIPSPAAGVVESVSIKLDDEVGTGDLILKL
KVKGAAPAAAPSPAAAAPSAPASAPAAAAPAAAPAAPAAAPAKPGAKVHAGPAVRQLARE
FGVELSAVGASGPHGRILKEDVQVYVKAMMQKAKEAPAAAGGATGGAGIPPIPVVDFSRF
GEIEEVPMTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTV
LPLLLKSCAHLLKELPDFNSSLAPSGKAIIRKKYVNIGFAVDTPDGLLVPVIKNVDQKSL
LQLAAEAASLAEKARTKKLSSDEMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKAT
IQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLSDLLGDIRTMLL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaagtaattgaactg
tttgtgaaggtaggcgaccgtatcgaagccgaccagagcatcctgacgctggaatcggac
aaggcgagcatggaagtgcctgcgccgaaggccggtatcatcaagagcctgaaagtgaag
ctgggcgaccgcctgaaagaaggcgacgaactgctggagctggaagtcgaaggtgccgct
gctgcagcccctgcggctgccgttgcaccggctgccaaggctgaagccaagccggctgct
gctcctgcagctgccgcccctgctgctgcgccggctgccgccagcgttcagcaagtgcac
gtgccggacatcggttcgtcgggcaaggcccagatcatcgagatccaggtcaaggtcggc
gacaccgttgcggctgatcagtcgctgatcaccctggaatccgacaaggccagcatggaa
atcccgtcgcctgccgctggcgtggtcaaggccatcagcgtcaagctcaacgacgaagtc
ggcaccggcgacctgatcctggatctggaagtggcgggtgctgcggcaccggctgccgcc
ccggcccaggctgccgctccagctgctgcagctgcaccggcacctgcagcagctccggct
gcaccggttgccgacagcgtccaggacatccacgttccggacatcggttcggcgggcaag
gccaagatcatcgaagtcctggtcaaggccggcgacaccgtcgtggccgaccagtcgctg
atcaccctggaatccgacaaggccagcatggaaattccatcgccagccgctggcgtggtg
gaaagcgtttccatcaagctcgatgacgaagtcggtaccggcgacctgatcctcaaactg
aaagtcaaaggcgctgccccggctgctgcaccgtcacctgccgctgctgctccgagcgct
cctgcttcggctccagccgctgctgcacctgccgccgcacctgctgccccggctgccgct
ccagccaagccgggcgcgaaagttcacgccggccctgccgtgcgtcaactggcccgtgag
ttcggcgtcgagctgagcgccgtgggcgccagcggtccgcacggtcgcatcctgaaagaa
gacgtgcaggtttacgtcaaggccatgatgcagaaggccaaggaagcaccggccgctgct
ggcggcgcaaccggtggcgccggcatcccgccgattccggtcgtggacttcagccgcttc
ggtgaaatcgaagaagtgccgatgacccgcctgatgcaggtcggtgctgccaacctgcac
cgcagctggctgaatgtgccgcacgtgacacaattcgattcggcggatatcaccgaactc
gaagcgttccgtgttgcccagaaagccgttgcagagaaggccggcgtcaagctgaccgtc
ctgccgttgctgctcaagtcctgcgcgcacctgctcaaggaactgccggacttcaacagc
tcgctggcaccaagcggcaaagcgatcatccgcaagaagtacgtgaacatcggcttcgcc
gtcgacaccccggatggcctgctggtaccggtcatcaagaacgtcgaccagaagagcctg
ctgcaactggctgccgaagccgcttccctggctgaaaaagcccggaccaagaagctttcg
tcggacgagatgcaaggcgcctgcttcaccatttccagcctgggccacattggcggcacc
ggcttcacgccgatcgtcaacgcgccggaagtggcaatcctcggtgtttccaaggccacc
atccagccagtctgggacggcaaagccttccagccgaaactgatgctgccactgtcgctg
tcctacgatcaccgtgtgatcaacggcgccgctgctgcacgcttcaccaagcgtctgagc
gacctgctgggcgacatccgcaccatgctcctgtaa

DBGET integrated database retrieval system