KEGG   Pseudomonas sp. UW4: PputUW4_00604Help
Entry
PputUW4_00604     CDS       T02357                                 

Gene name
recD
Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PputUW4_00604 (recD)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PputUW4_00604 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702723..704825
Genome map
AA seq 700 aa AA seqDB search
MNRSFADLLPTSLAAESLADLAPLSRADDLLLLLTRWVERGWLRALDKAFVAFLHELAPE
DDPLVLLAAALTSHQLGHGHVCLDLFETLKEPDFALSLPPEGDVQGGAMLLPSQLLGSLD
GAHWCKVLAASNLVALAADSRDNVRDRPLVLSGKRLYLRRYWAYERRIDLSLRERLTEHE
STPNDLLQRLTGLFGPARPGEVIDWQKLACALATRSAFSIVTGGPGTGKTTTVVRLLALL
QAPAVEAGMPLRIRLAAPTGKAAARLTESISQQVRTLKVSEAIREKIPSDVTTVHRLLGS
RPGTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPAHARLVLLGDKDQLASVEA
GAVLGDLCRDAEAGWYSPQTRQWLEAVSGESLQAGGLQEDTQGAHPLAQQVVMLRHSRRF
GEGSGIGQLARWVNQQQPEEARKLLSARSHDDVYGLSLKGEQDRTLERLLLEGHGEGPQG
YRHYLTLLRKQRPPLDSPLDDSSWTDWAREVLQAFDAFQLLCAVRKGPWGVEGLNQRVTD
ALLRARLIDSDQQWYEGRPVLMTRNDYGLGLMNGDIGIALKLPEQEGHGKQVLRVAFPRN
DGQGGVRFVLPSRLNDVETVYAMTVHKSQGSEFAHTALILPDALNPVLTKELIYTGITRA
KDWFTLIESRAGVFEEAVKRRVKRLSGLMLELKDGSELAG
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctcattcgccgatttgctgccgacatcgctggcagctgaaagcctggccgat
ctggcgccgctgagtcgtgccgacgatttgctgttgctgctcacgcgctgggtcgaacgt
ggctggctgcgcgcgctggacaaagcttttgtggcgtttctgcatgagctggcaccggag
gatgatccgttggtcttgctggcagccgcgttgactagccaccagttgggccacgggcat
gtctgcctcgacctgttcgagacgctgaaagaaccggacttcgccctgtcattaccaccc
gaaggtgacgtacaaggcggcgccatgctgttgccgtcgcaattgctcggatcgctggac
ggtgctcattggtgcaaggtgctggccgccagtaacctggtcgcactggccgccgacagc
cgtgacaacgtgcgtgaccgacctttggtgttatcgggcaagcgcttgtacctgcgccgc
tattgggcctacgagcggcggatcgacctttcgctacgcgagcgcctgacggaacacgag
tccacgccgaacgacctgctgcagcgcctcaccggtttgtttgggcctgcccggccgggt
gaagtgatcgactggcagaagctggcctgcgccctggcgacccgcagcgccttcagcatc
gtgacgggggggccgggaaccggcaagaccaccaccgtcgtgcgcttgctggcgttgctc
caggcgccggcggtcgaagccggcatgccattgcgcattcgcctcgccgcaccgaccggc
aaggccgcggcgcgtctgacagagtccatcagccagcaagtccggaccctgaaggtcagc
gaagcaatacgcgagaaaatcccgtcggatgtcaccaccgttcaccgtctgctgggcagt
cggcccgggacacggcatttccggcaccatgcgggcaatcgcctgccgctggatgtgctg
gtggtggacgaggcctcgatgatcgacctggaaatgatggccaatctgctcgacgccttg
ccggcccatgcacgcctcgtgctgttgggggacaaggaccaattggcttcggtagaagcc
ggtgcggtactgggggatctgtgtcgtgacgcggaggctggctggtacagcccgcagaca
cgccagtggctggaagccgtcagcggcgaaagcctgcaggccggcggattgcaggaggat
acgcagggcgctcatccactggcccaacaggtggtgatgttgcgccattcccggcgattc
ggtgagggcagtggtattggtcagctcgctcgttgggtcaaccagcagcaaccggaagaa
gcccgcaagttgttgtctgcgcgaagccatgacgatgtgtatggcttgtccctcaagggc
gagcaagaccggaccctggagcgtttgctgctcgaaggccatggtgaggggccgcagggt
tatcggcattacctgaccttactgcgtaaacaacggccgccactcgacagcccgctggac
gattcgagctggaccgactgggcccgggaggtgttgcaagcctttgacgcgttccagctg
ttatgtgccgtgcgcaaggggccgtggggtgtggagggcctgaaccagcgggtgacggac
gcgttgctcagggcacgcctgatcgacagcgaccaacagtggtacgaaggtcgccccgtg
ctgatgacccgcaacgattacgggctgggcttgatgaacggcgatattggcatcgccctc
aaactcccggagcaggagggccacggaaaacaggttttgcgtgtggcgttcccacgcaat
gacggtcagggcggcgtgcgatttgtcctgccaagccgtctgaatgatgtcgaaaccgtg
tacgccatgactgtgcataaatcccaaggctcggagttcgcgcataccgcgttgattctt
cctgacgccttgaatccggtcctcaccaaggaattgatctacaccgggattacccgggcc
aaggattggttcaccctgatcgaatcgcgcgcaggcgtatttgaagaggcggtgaaacgc
cgggtcaagcgcttgagcgggctgatgctggaactgaaggacggcagcgagctggcaggc
tga

DBGET integrated database retrieval system