KEGG   Pseudomonas sp. UW4: PputUW4_00722Help
Entry
PputUW4_00722     CDS       T02357                                 

Gene name
phoD2
Definition
exported alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PputUW4_00722 (phoD2)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PputUW4_00722 (phoD2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputUW4_00722 (phoD2)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PputUW4_00722 (phoD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
867433..869022
Genome map
AA seq 529 aa AA seqDB search
MSDFNLGRRRVMQAVGAGLLLPGLAPAVIASVKDRPQLTDGVQSGDLLGDRAIIWSRCDR
PARMVVEWDTRSLFPDPRRFVSPLADARTDFTARVELTGLPADQAIFYRVQFEDAQSGVA
SEPWFGHLRSVPQTRRDIRFLWSGDTAGQGFGINPDIGGMRIYEAMRRRLPDFFIHSGDT
IYADNPIPAQLSAEGGRVWRNITTEAKSKVALTLDEYRGNYRYNLMDENIRRFNAEVPQI
WQWDDHEVMNNWSPGKKPDARYQSKDIHSLVDRARQAWLEYAPMRLQSAEGGGRIYRKLG
YGPLLDVFVLDMRSYRGANDDNLGEARPFLGREQLDWLKREMQTSNAQWKVIATDMSIGL
GAPDGEVSPGVTRWEAVANGDPGPARGRELEIAELLGFLRAQQVRNFLFLTADVHYCAAH
HYHPDRAAFQDFEPFWEFIAGPLNAGSFGPDSLDMTFGPEVVFEKASPVHNASPLAGFQF
FGEVNIDGQTGELNVVLRDLDGVSVFEQKLSPCDSAVARYVGNDFCTKS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttcaatctcgggcgccgtcgtgtcatgcaagcggtcggcgccgggttgttg
ttgccggggctggcgccggcggtgatcgcttcggtcaaggatcggccgcaactcaccgat
ggcgtgcagtctggcgacctgctgggtgaccgggcgatcatctggagccgctgcgaccgc
cccgcacggatggtggtggagtgggacacccgcagcctgtttcccgaccctcggcgattc
gtctcgcccctggctgatgcgcgcaccgatttcactgcccgggtcgaactcaccgggctg
cccgccgaccaggcgattttctatcgagtgcaatttgaagacgcccagagcggtgttgcc
agtgaaccctggttcggtcacttgcgcagcgtgccgcagacccggcgcgacatccggttt
ctctggagtggcgacacggccggccaaggctttggtatcaacccggacattggcggcatg
cgcatctacgaggcgatgcgccggcgcctgccggacttctttatccacagcggcgatacc
atttacgccgacaacccgatcccggcgcagctcagcgcggaaggcggccgggtgtggcgc
aacatcaccacagaggccaagagcaaagtcgctctgaccctcgatgagtatcgcggcaat
taccgctacaacctgatggacgaaaacattcgccgcttcaatgccgaggtcccgcagatc
tggcagtgggacgaccacgaagtgatgaacaactggtcgccgggcaaaaagccggatgca
cgataccagagcaaagatatccacagcctggtggaccgcgcacgtcaggcctggctcgaa
tacgcgccgatgcgcttgcagagtgccgagggtggcgggcggatctatcgcaagctcggt
tacgggccactgctggatgtgttcgtgctggacatgcgcagttatcgcggggccaacgac
gacaaccttggcgaagccaggccgtttctcgggcgtgagcaactggactggctcaagcgc
gaaatgcagacctcgaacgcgcaatggaaagtgatcgctactgacatgtccatcggcctt
ggcgcgcctgacggtgaagtcagccccggtgtcacgcggtgggaagcggtggccaacggc
gaccctggacctgcccggggtcgcgaactggaaatcgccgaactgctcggtttcctgcgg
gcgcagcaggtgcgcaatttcctgtttctgacggcggatgtgcattactgcgcggcccat
cattaccacccggatcgggcggcgttccaggacttcgaaccgttctgggagtttattgcc
gggccgttgaatgcgggcagtttcgggcctgactcgctggatatgacctttggccctgaa
gtggtattcgagaaggcctcccctgtgcataacgcctcgccgcttgccggatttcagttt
ttcggcgaggtgaatatcgatggacagacgggggagttgaacgtggtgttgcgcgatctg
gatggcgtgtcggtattcgagcaaaaactgtcaccgtgtgactcggcagttgctcgctat
gtgggaaatgatttttgcacaaaaagctga

DBGET integrated database retrieval system