KEGG   Pseudomonas sp. UW4: PputUW4_00789Help
Entry
PputUW4_00789     CDS       T02357                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppuu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppuu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944118..945383
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNSALPILAATLLCDGPVTVANLPHLHDITTMIELFGRM
GIEPVIDEKLAVEIDPRTIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAVIDVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFLNAMGAKVSGAGTDTITIDGVERLHTTTYKVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLRESGAEITCGEDWIELNMHGKRPKAVNVRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYELHRMGAKIQVEGNTAIVTGT
EKLKGAPVMATDLRASASLVISALVAEGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaattgattattactggcggtgctcgtcttgacggcgaaatccgcatctccggg
gcaaagaactctgccctgccgatcctggctgccacgctgctgtgcgatggtccggtgacc
gttgccaacctgccgcacctgcacgacatcaccaccatgatcgaactgttcggtcgcatg
gggatcgagccggtgatcgacgaaaaactcgccgtcgaaatcgacccgcgcaccatcaag
accctggtcgcaccgtacgaactggttaaaaccatgcgtgcgtcgatcctggtactgggc
ccgatggttgcccgtttcggcgaagccgaagtcgcgctgcctggcggttgcgccatcggt
tcgcgtccggttgacctgcacatccgtggcctggaagccatgggcgcggtcatcgacgtc
gaaggcggctacatcaaggccaaggcgcctgagggcggcttgcgcggtgcgcacttcttc
ttcgacaccgtcagcgtgaccggtaccgaaaacatcatgatggccgccgcactggccaag
ggccgcagcgtcctgcaaaacgccgcgcgcgaacctgaagtggtcgacctggcgaacttc
ctgaacgccatgggcgccaaggtttccggcgccggcaccgataccatcaccatcgatggc
gtcgagcgtctgcacaccaccacttacaaagtgatgcccgaccgtatcgaaaccggcacc
tatctggtggcggcggctgtgaccggtggtcgcgtgaaggtcaaggacacggatccgacc
atcctcgaagccgttctggaaaaactccgggagtccggtgcagaaatcacctgcggcgaa
gactggatcgagctgaacatgcacggcaagcgtccgaaagccgtcaacgtgcgcaccgct
ccgtacccggcgttcccgaccgacatgcaagcgcagttcatctccctcaacgccattgcc
gaaggcacgggtgctgtgatcgagacgatcttcgaaaaccgcttcatgcacgtctacgaa
ctgcaccgcatgggcgccaagatccaggtcgagggcaacaccgcgatcgtcaccggtacc
gagaagctcaagggcgcgccagtgatggcaactgacctgcgtgcttcggccagcctggtg
atctcggccctggtcgccgagggcgacaccctgatcgaccgcatctaccacatagaccgt
ggctacgagtgcatcgaggaaaaactgcagatgctgggcgccaagatccgtcgcgttccg
ggctag

DBGET integrated database retrieval system