KEGG   Pseudomonas sp. UW4: PputUW4_00791Help
Entry
PputUW4_00791     CDS       T02357                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppuu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppuu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
946269..947594
Genome map
AA seq 441 aa AA seqDB search
MTALTAIRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVDFTRQ
FDGLEVKSMADLILPRERLELALTRISVAQREALEVAAARVRSYHEKQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPKVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAGFLDKVAASIAKLMPTMER
AAIIETSINGRGALIKVRDMEQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARG
ESLTAHARSAEYRIVDDKQVK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgactgcaattcgccgactcaacgctgctgacccggatttcgcgcatcat
ctggatcatctgctgagctgggaaagtgtgtctgacgactcggtcaatcagcgggtgctg
gacatcatcaaggccgtgcgcgaacgcggtgacgcggcgctggtggacttcacccgtcag
ttcgacggcctggaagtgaagtccatggccgatctgatcctgccgcgcgagcgtctggag
ttggcactgacccgcatctccgtggcccagcgcgaagcactggaagtcgccgcagcccgc
gtgcgcagctaccacgagaagcagaagcaggactcctggagttacaccgaggcggacggc
accgtactgggccagaaagtcacgccgctggatcgtgccggtctgtacgtgccgggcggg
aaggcgtcgtacccgtcgtcggtgttgatgaacgcgattccggccaaggtggccggcgtt
accgaagtggtcatggtcgtaccgaccccgcgcggtgaaatcaacgagcttgtgctggct
gcggcctgcatcgccggtgtcgaccgcgtgttcaccatcggtggcgcccaggccgttgcg
gcgctggcttacggcaccgaaagcgtaccgaaggtcgacaaggtcgtcggcccgggcaac
atctatgtggctaccgccaagcgccacgtgtttggccaggtcggcatcgacatgatcgcc
ggcccttcggaaatcctcgtggtgtgcgacggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgagcacgacgaagacgcccaggccattctggtcagccccgac
gccgggttcctcgataaggtcgccgccagcatcgccaaattgatgccgaccatggagcgt
gccgcaatcatcgaaacctcgatcaatggccgtggtgcactgatcaaggttcgcgacatg
gaacaggccatcgaagtggccaaccgcatcgcgccggagcacctcgagttgtccgttgcc
gatccgcaagcctggctgccacagatccgccacgccggcgcgatcttcatgggccgtcac
acctccgaagctctgggcgactactgcgcaggcccgaaccacgtgttgccgacctccggc
accgcgcgattctcttcgccgctgggtgtgtatgacttccagaaacgctcgtcgatcatc
ttctgttccgagcagggcgcatcggaactgggcaagaccgcatccgtgctggcccgtggc
gagtcgctgaccgcgcacgcgcgtagcgccgaataccgcatcgttgacgacaagcaggtg
aaatga

DBGET integrated database retrieval system