KEGG   Pseudomonas sp. UW4: PputUW4_00810Help
Entry
PputUW4_00810     CDS       T02357                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppuu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965982..966542)
Genome map
AA seq 186 aa AA seqDB search
MTLSLPQNYREILIGLGENPDREGLLDTPVRAAKAMQYLCHGYEQSVEEIVNDALFASDN
DEMVIVDNIELYSLCEHHMLPFIGKAHVAYIPTGKVLGLSKIARLVDMFARRLQIQENLT
RQIADAVQQVTGAAGVAVVIEAQHMCMMMRGVEKQNSTMNTSVMLGAFRESSNTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacgttatccctgccccagaattatcgagagatcctcatcggcctcggtgaaaatcca
gaccgcgaaggcctgctcgacaccccggtgcgcgcagccaaagccatgcagtacctttgc
catggctacgaacaaagtgtcgaagagatcgtcaatgacgcgctgttcgcctccgacaac
gatgaaatggtgatcgtcgacaacatcgagctgtattcgctttgcgaacaccacatgctg
cccttcattggcaaggcgcatgtggcttatattccaaccggcaaggtgctggggctgtcg
aagattgcgcggctggtggacatgttcgcccggcgcctgcaaatccaggaaaacctcacc
cggcaaatcgccgacgccgtgcaacaggtgaccggtgcggcaggcgtcgcagtggtcatc
gaagcgcagcacatgtgcatgatgatgcgcggcgtcgagaaacagaattcgaccatgaac
acctccgtgatgctcggcgctttccgcgagtcgagcaacacccgccaggagttcctgcaa
ttgattggacggagcaagtag

DBGET integrated database retrieval system