KEGG   Pseudomonas sp. UW4: PputUW4_00811Help
Entry
PputUW4_00811     CDS       T02357                                 

Definition
short chain dehydrogenase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PputUW4_00811
   00670 One carbon pool by folate
    PputUW4_00811
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PputUW4_00811
    1.5.1.-  
     PputUW4_00811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966563..967273)
Genome map
AA seq 236 aa AA seqDB search
MTSSAAPILITGAGQRVGLHCARRLLEDGHRVIFSYRSERPGVQALRDLGASAVFADFAS
EAGILAFISELKTHTDCLRAIIHNASEWLAETPDTDAAAFTRMFSVHMLAPYLINLHCAD
LLQRSSPADIVHISDDVTRKGSSKHIGYCASKAGLDSLTLSFAARYAPDIKVNGIAPALL
LFNPEDDATYRSKALAKSALGIEPGCEVIYQSLRYLLDNPYVTGTTLTVNGGRHIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttccgcagcccctatcctgattaccggcgccggccagcgtgtcggcctgcac
tgcgcccggcgattgctggaagacggccatcgcgtgattttcagctaccgcagcgagcgg
cccggcgtacaagccctgcgcgacctgggggccagcgccgtgttcgcggacttcgccagc
gaggccgggatcctcgccttcatcagtgaactgaaaacccacaccgactgtttgcgggcg
attatccacaacgcctccgaatggctggcggaaacaccggacactgacgctgcagcattc
acccgcatgttcagcgtgcacatgctggcgccctacctgatcaacctgcactgcgccgat
ctgctgcaacgttcaagccccgcagacatcgtgcacatcagcgatgacgtgacccgcaag
ggcagcagcaagcacatcggctattgcgccagcaaagccggactcgacagcctgaccctg
tccttcgccgccaggtatgcgccggacatcaaggtcaacgggattgcgcccgccctgcta
ctgttcaaccctgaagacgacgcgacctaccgctccaaggcactggccaagtccgctctg
ggcatcgaacccggctgcgaagtgatctaccagagcctgcgctatctgctcgacaaccct
tatgtcaccggcaccaccctgaccgtcaacggcggaaggcacatcaagtaa

DBGET integrated database retrieval system