KEGG   Pseudomonas sp. UW4: PputUW4_01045Help
Entry
PputUW4_01045     CDS       T02357                                 

Gene name
wspF
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputUW4_01045 (wspF)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputUW4_01045 (wspF)
Two-component system [BR:ppuu02022]
 CheA family
  WspE-WspRF
   PputUW4_01045 (wspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242764..1243774
Genome map
AA seq 336 aa AA seqDB search
MRIAIVNDMPMAVEALRRALAFEPTHEVVWVAGNGAEAVRLCAQDTPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRQQNVHRVFEAMGHGALDVVDTPTVGAGNAQEAAAPLL
RKIINIGWLIGDKGNRPRPAPAPLRSSGSRQSLIAIGSSAGGPAALEVLLKGLPRDFSPA
IVLVQHVDQVFAAGMAEWLGSASGLNVRLAEEGEKPQSGTVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVASYWNGDAVGVLLTGMGRDGAQGLKLMRQQGYLTIAQDQG
SSAVYGMPKAAAAIDAAVEIRPLDKIAPRLLEIFAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgcaatcgtcaacgacatgcccatggcggtagaggccctgcgccgcgccctg
gcattcgagccgacacacgaggtggtctgggtcgccggcaatggcgccgaagcggtgcgc
ctgtgcgcgcaggacacgccggacctgatcctgatggacctgatcatgccagtgatggat
ggcgtcgaggccacgcggcggatcatggccgagaccccgtgcgccattgtcatcgtcacc
gtggatcgccagcagaacgtgcaccgggtgttcgaggccatgggccacggtgcgctggac
gtagtcgacaccccgaccgtcggcgccggcaatgcccaggaggcggctgcgccgttgttg
cgcaagatcattaacattggctggctgatcggcgacaagggcaaccgcccgcgcccggcg
ccggcaccgttgcgcagttcgggctcacgccagagcctgatcgccattggctcatctgcc
ggtgggccggcggcgctggaagtcttgctcaagggcctgccgcgtgatttctctccggcc
atcgtgctggtgcagcacgttgaccaggtgtttgccgccggcatggctgaatggctcggc
agcgccagcggcctcaacgtgcgcctggccgaggaaggcgagaagccgcaaagcggcacg
gtattgctggccggcaccaatcaccatattcgcttgctgaaaaacggcacgctggcctac
accgccgaaccggtcaacgaaatctaccggccctccatcgatgtgttcttcgagagcgtg
gccagttactggaacggtgacgccgtgggggtattactcaccggcatggggcgtgatggc
gcccaggggcttaaactcatgcgccaacagggctacctgaccatcgcacaagaccagggc
agcagtgcggtgtatggcatgccgaaggcggccgcagccatcgacgctgccgtggagatt
cgcccgctggacaagatagcgccacgattgctggagattttcgccaaatga

DBGET integrated database retrieval system