KEGG   Pseudomonas sp. UW4: PputUW4_01117Help
Entry
PputUW4_01117     CDS       T02357                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppuu  Pseudomonas sp. UW4
Brite
Enzymes [BR:ppuu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PputUW4_01117 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1323382..1324059
Genome map
AA seq 225 aa AA seqDB search
MGREQDDMLRRGIGMTSQRTRERLIQRLYEEGISNARVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGNNQTISQPYMVARMSELLLEAGPLDKVLEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRMVIPVGAGEVQQLMLIIREEQGFSRHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcgaacaagacgatatgctgcgtcgcggcatcggcatgacctcccagcgaacc
cgggagcggctcatccagcgcctgtatgaagaaggtatctccaacgcgagggtgctggag
gtcattcgccggaccccgcgtcacctgttcgtcgatgaagcgctggcgcaccgtgcctat
gaagacaccgcgctgccgattggcaacaaccagaccatctcccagccttatatggtggcg
cgcatgagcgagctgctgctggaggccggtcccctcgacaaggtgctggaaatcggcacc
gggtcgggttatcagacggcagtgctgtcgcaactggtcgagcgtgtgttctcggtcgag
cgcatcaaggttctgcaggatcgggcaaaggaacgtctggtcgaactgaacctgcgcaac
gtggtgttccgctggggcgatggttgggaaggctggccggcactggcgccgtacaacggg
attatcgtcaccgccgtggcgactgacgtgccccaggcattgcttgaccagttggcaccg
ggaggccgaatggtgatcccggtcggggccggcgaagtccagcaattgatgctgatcatc
cgcgaggaacaaggtttttccaggcatgttctgggagctgtgcgcttcgtgccattgctc
aatgggccattggcctga

DBGET integrated database retrieval system