KEGG   Pseudomonas sp. UW4: PputUW4_01242Help
Entry
PputUW4_01242     CDS       T02357                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00051  Fructose and mannose metabolism
ppuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PputUW4_01242
Enzymes [BR:ppuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PputUW4_01242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFY18449
UniProt: K9NF56
Position
complement(1453239..1454021)
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKEQLVKHALSQMQNTLADNTWTARQKLALTCRILFEHGHDSGLAGQITARGP
QPGTYYTQQLGLGFDEITAGNLLLVNEDLEVLEGHGMPNPANRFHSWVYRARPDVNCIIH
THPTHVAALSMLEVPLQISHMDLCPLYEDCAFLEGWPGVPVGNEEGELIAGALGDKRAIL
LSHHGQLSTGNTIEEACVIAQLIERAAKLQLLAMSAGTIKPIIPALGREAHDWIARPKRH
AAAFNYYARQSLRQHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcactgcccaaagagcaactggtcaagcacgcgctgagccaaatg
caaaataccctggcggataatacgtggaccgcccggcaaaagctggccctgacctgccgc
attctgttcgagcacggtcacgattccggtcttgccgggcaaatcaccgcccgtggcccg
cagcccggcacttactacactcaacaactgggcctgggtttcgacgaaatcaccgcaggc
aacctgctgctggtcaacgaagacctggaggtgctggaaggccacggcatgcccaacccg
gccaatcgttttcacagttgggtataccgcgcccgtccggatgtgaactgcatcatccac
acccatccgacccacgttgcagccttgtcgatgctggaagtaccgttgcagatttcccac
atggacctctgcccgctctatgaagactgtgcgtttctcgaaggctggccaggtgtgccg
gtgggcaacgaggaaggcgagttgattgccggggcgttgggcgacaagcgggcgatcctg
ctttcgcaccacggccaattgtccaccggcaataccatcgaggaagcctgtgtcatcgcg
caactgatcgaacgtgccgcgaagctgcaattgctggcgatgagcgccgggaccattaag
ccgatcatccccgcgctgggccgtgaagcccatgactggattgcccggccgaaacgtcac
gccgccgctttcaactactacgcccggcagagcctgcgccaacacgccgattgcctgaac
tga

DBGET integrated database retrieval system