KEGG   Pseudomonas sp. UW4: PputUW4_01242Help
Entry
PputUW4_01242     CDS       T02357                                 

Definition
class II aldolase/adducin domain-containing protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PputUW4_01242
Enzymes [BR:ppuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PputUW4_01242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1453239..1454021)
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKEQLVKHALSQMQNTLADNTWTARQKLALTCRILFEHGHDSGLAGQITARGP
QPGTYYTQQLGLGFDEITAGNLLLVNEDLEVLEGHGMPNPANRFHSWVYRARPDVNCIIH
THPTHVAALSMLEVPLQISHMDLCPLYEDCAFLEGWPGVPVGNEEGELIAGALGDKRAIL
LSHHGQLSTGNTIEEACVIAQLIERAAKLQLLAMSAGTIKPIIPALGREAHDWIARPKRH
AAAFNYYARQSLRQHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcactgcccaaagagcaactggtcaagcacgcgctgagccaaatg
caaaataccctggcggataatacgtggaccgcccggcaaaagctggccctgacctgccgc
attctgttcgagcacggtcacgattccggtcttgccgggcaaatcaccgcccgtggcccg
cagcccggcacttactacactcaacaactgggcctgggtttcgacgaaatcaccgcaggc
aacctgctgctggtcaacgaagacctggaggtgctggaaggccacggcatgcccaacccg
gccaatcgttttcacagttgggtataccgcgcccgtccggatgtgaactgcatcatccac
acccatccgacccacgttgcagccttgtcgatgctggaagtaccgttgcagatttcccac
atggacctctgcccgctctatgaagactgtgcgtttctcgaaggctggccaggtgtgccg
gtgggcaacgaggaaggcgagttgattgccggggcgttgggcgacaagcgggcgatcctg
ctttcgcaccacggccaattgtccaccggcaataccatcgaggaagcctgtgtcatcgcg
caactgatcgaacgtgccgcgaagctgcaattgctggcgatgagcgccgggaccattaag
ccgatcatccccgcgctgggccgtgaagcccatgactggattgcccggccgaaacgtcac
gccgccgctttcaactactacgcccggcagagcctgcgccaacacgccgattgcctgaac
tga

DBGET integrated database retrieval system