KEGG   Pseudomonas sp. UW4: PputUW4_01409Help
Entry
PputUW4_01409     CDS       T02357                                 

Definition
acyl-CoA thioesterase I (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PputUW4_01409
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PputUW4_01409
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PputUW4_01409
Lipid biosynthesis proteins [BR:ppuu01004]
 Fatty acid synthase
  Component type
   PputUW4_01409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646785..1647390
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRLGWVSLLEQRLRREGFDDKV
INASISGDTSAGGQARLPALLAEHKPELVILELGGNDGLRGLLPTQLQQNLASMIDSSRA
SGAKVLLLGMQLPPNYGARYTKAFAEVYSNLADEKKIPLVPFFLDGVGGHPELMQADGIH
PAAGAQDKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtctggtttttgagtgctggcctggccttgatgtgcatggcccaaaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgccggtttcgggctggatacccgg
ctggggtgggtgtcgctgcttgaacaacggctcaggcgcgaaggtttcgacgacaaagtg
atcaatgcgtccatcagtggcgacaccagtgccggaggccaggcgcgcctgcccgcgctg
cttgcagagcataaaccggaactggtgatcctcgagttggggggcaatgatggcctgcgc
ggtttgctgccaactcaattgcaacaaaatcttgcttcgatgatcgacagctcccgggcc
agcggtgccaaggtgttgttgctcggcatgcaattgccacccaattatggtgcgcgttac
accaaggcgttcgccgaggtctacagcaacctggccgatgagaaaaagatcccgctggtg
ccgtttttcctcgacggcgtgggggggcatccggagttgatgcaggccgacggcatacac
ccggccgccggggcccaggacaagttgctggaaaatgtctggcctactctaaaaccgctg
ttatga

DBGET integrated database retrieval system