KEGG   Pseudomonas sp. UW4: PputUW4_01622Help
Entry
PputUW4_01622     CDS       T02357                                 

Definition
(GenBank) glutathione S-transferase (EC:2.5.1.18)
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ppuu  Pseudomonas sp. UW4
Brite
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PputUW4_01622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1913051..1913761
Genome map
AA seq 236 aa AA seqDB search
MTDLSAFPITRKWPAQYPEWIQLYSLPTPNGVKVSIMLEEIGLPYEPHRVGFDTNDQMSP
EFLSLNPNNKIPAILDPHGPDDKPLALFESGAILIYLADKSGQLLAQESAARYETIQWLM
FQMGGIGPMFGQLGFFNKFAGKDYEDKRPRDRYVEESKRLLKVLDGRLQGRDWIMGERYT
IADIATFPWVRNLIGFYEAGDLVGIQNFPNVTRVLERFLARPAVVRGLQIPSPVAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttgtccgccttccccatcacccgcaaatggcctgcccaatacccggagtgg
attcagctgtactccttgccgacccccaacggcgtcaaggtctcgatcatgctcgaagag
atcggcctgccgtatgagcctcaccgggtaggctttgacaccaatgaccagatgtccccg
gaattcctgtcgttgaaccccaacaacaagatcccggcgatcctcgacccccacggtccg
gacgacaaaccgctggcgctgttcgagtcgggagcgattctgatctacctggccgacaag
agtgggcaactgctggcccaggaatcggccgcgcgttacgaaacgattcaatggctgatg
ttccagatgggcggcattggcccgatgttcggccagctcgggttcttcaacaaattcgcc
ggcaaggactacgaagacaagcgtccccgtgatcgctatgtcgaggagagcaaacgcctg
ctcaaggtgctcgacggccggctccaagggcgcgactggatcatgggtgagcgctacacc
atcgccgacatcgccaccttcccgtgggtacgcaacctgattgggttctatgaagccggc
gatctggtgggcattcagaatttcccgaacgtcacacgggtgctggagcgcttcctggca
cggccggcggtggtgcgcgggttgcagattccaagcccggtcgcgggttga

DBGET integrated database retrieval system