KEGG   Pseudomonas sp. UW4: PputUW4_01661Help
Entry
PputUW4_01661     CDS       T02357                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PputUW4_01661 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputUW4_01661 (mhpF)
   00650 Butanoate metabolism
    PputUW4_01661 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputUW4_01661 (mhpF)
   00622 Xylene degradation
    PputUW4_01661 (mhpF)
   00621 Dioxin degradation
    PputUW4_01661 (mhpF)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PputUW4_01661 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PputUW4_01661 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1952069..1952977
Genome map
AA seq 302 aa AA seqDB search
MSKKLRAAIIGPGNIGTDLLMKMCRSQWIEPVWMVGVDPESEGLKRAREMGIKTTADGVD
GLLPHVLDDDIRIAFDATSAYVHAQNSRKLNELGVIMIDLTPAAIGPFCVPPVNLKEHAS
SLAMNVNMVTCGGQATIPMVAAVSRVQPVSYGEIVATVSSGSVGPGTRQNIDEFTRTTAG
AVEKIGGARRGKAIIVINPAEPPLMMRDTIHCLTDDEPNQDAIRTSVLDMVREVQRYVPG
YKLINGPVFDGRKVSIFIEVEGLGDFLPKSAGNLDIMTAAGLRTAEMFAEEAHKGTLQLP
VR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaactcagagcggccattatcggcccgggcaatatcggcaccgatctgctg
atgaaaatgtgccgatcgcaatggatcgagccggtatggatggttggcgtcgaccctgaa
tccgaaggcctgaaacgagcccgggaaatgggcatcaaaaccaccgccgacggtgtcgat
ggcttgctgccgcacgtgctcgacgatgatattcggatcgctttcgacgccacctcggcc
tacgtgcatgcgcaaaacagtcgcaagctcaacgagctcggggtgatcatgatcgacctc
acgccggcggccatcggcccgttctgcgtgccgccggtcaacctcaaggagcacgcgtcg
agcctggcaatgaacgtcaacatggtcacctgcggtggccaggcgaccatcccgatggtg
gcggcggtgtcgcgggtgcaaccggtgagctacggcgaaatcgttgccaccgtgtcgtcc
ggttcggttggcccgggtacccggcagaacatcgatgaattcacccgcaccacggccggt
gcggtggagaagatcggcggcgcccgacgcggcaaggcgatcatcgtcatcaacccggcc
gagccgccgctgatgatgcgcgacaccatccactgcctgaccgatgacgagccgaaccag
gatgcgatccgcacctcggtgctggacatggttcgcgaggtgcagcgctatgtgcccggc
tacaagctgatcaacgggccggtgttcgacgggcgcaaggtgtcgatcttcatcgaggtc
gaaggcctcggcgacttcctgcccaagtctgccggcaacctcgacatcatgaccgccgcc
ggtttgcgcacggccgagatgttcgccgaagaagcccacaagggcaccctgcaactgcct
gtccgttga

DBGET integrated database retrieval system