KEGG   Pseudomonas sp. UW4: PputUW4_01692Help
Entry
PputUW4_01692     CDS       T02357                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00071  Fatty acid degradation
ppuu00280  Valine, leucine and isoleucine degradation
ppuu00281  Geraniol degradation
ppuu00310  Lysine degradation
ppuu00360  Phenylalanine metabolism
ppuu00362  Benzoate degradation
ppuu00380  Tryptophan metabolism
ppuu00410  beta-Alanine metabolism
ppuu00627  Aminobenzoate degradation
ppuu00640  Propanoate metabolism
ppuu00650  Butanoate metabolism
ppuu00903  Limonene and pinene degradation
ppuu00930  Caprolactam degradation
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
ppuu01212  Fatty acid metabolism
Module
ppuu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputUW4_01692
   00650 Butanoate metabolism
    PputUW4_01692
  Lipid metabolism
   00071 Fatty acid degradation
    PputUW4_01692
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputUW4_01692
   00310 Lysine degradation
    PputUW4_01692
   00360 Phenylalanine metabolism
    PputUW4_01692
   00380 Tryptophan metabolism
    PputUW4_01692
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputUW4_01692
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputUW4_01692
   00281 Geraniol degradation
    PputUW4_01692
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputUW4_01692
   00627 Aminobenzoate degradation
    PputUW4_01692
   00930 Caprolactam degradation
    PputUW4_01692
Enzymes [BR:ppuu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputUW4_01692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFY18897
UniProt: K9NH23
Position
1986638..1987393
Genome map
AA seq 251 aa AA seqDB search
MKPFSVSIEHGIAELVFNRPPVNAFNNQGWADIASEIEGLGRNDDVRVILIRAEGRGFCA
GVDIKELAADGNLIVAVNKGNYDSFKAIHRNPKPVIVAVHGFVLGGGIGICGAADIIVAS
ECATFGVPEVDRGAMGGGAHLQRLFPVQKVRHMYFTGEPIDAAEAYRLGAVEQVVKREDL
REAALQIARTIAAKSPGMISLAKEALTGIEDGNLEDKYRWEQGFTLEAYRSLDSQEARDS
FVEKRDARFNG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatttagcgtcagcatcgaacacggcattgccgaactggtgttcaaccggcca
ccggtcaacgccttcaacaaccagggctgggctgatatcgccagcgagatcgagggcctg
ggccgcaacgacgacgtgcgggtgatcctgatccgtgctgaaggtcgcggcttctgtgcc
ggggtcgatatcaaggaactggccgccgacggcaacctgatcgtcgcggtgaacaagggc
aactacgacagcttcaaggccattcaccgcaacccgaaaccggtgatagtggccgtgcac
ggcttcgtgctgggcggcggcatcggcatctgcggcgctgccgacatcattgtcgcgtcc
gagtgcgccaccttcggcgtgccggaagtggatcgcggggccatgggtggcggcgcgcat
ttgcagcgcctgttcccggtgcagaaggtccgccacatgtacttcaccggcgagccgatc
gacgccgccgaagcttaccgcctgggcgcggtggagcaggtggtcaagcgcgaagacttg
cgcgaagccgcgttgcagatcgcccgcaccatcgccgccaagagcccgggcatgatcagc
ctggccaaggaagcgctgacaggcatcgaagacggcaatctggaagacaaataccgctgg
gagcagggcttcaccctcgaagcctaccgctcactggactctcaggaagcacgcgactcg
ttcgtcgagaaacgcgatgcccgattcaacggctga

DBGET integrated database retrieval system