KEGG   Pseudomonas sp. UW4: PputUW4_01813Help
Entry
PputUW4_01813     CDS       T02357                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00630  Glyoxylate and dicarboxylate metabolism
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PputUW4_01813 (aceA)
Enzymes [BR:ppuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PputUW4_01813 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFY19018
UniProt: K9NIN0
Position
complement(2139652..2140977)
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYSAADVVRLRGSVQPEHTFAKMGAEKLWNLVT
QGAKPAFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDAGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGSSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgaaaaagactgggctgaaaacccg
cgctggaaaggcgtgactcgcacttactccgctgctgacgtcgtccgcctgcgtggctcg
gttcaacctgagcacacctttgcaaaaatgggcgccgagaagctgtggaacctggtcacc
cagggtgccaagccagccttccgtcctgagaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtgcaacaagtcaaagccggcatccaggcaatctacctgtcgggc
tggcaggttgctgcggacaacaactccgccgaatcgatgtacccggaccagtcgctgtac
ccggtggactcggttccaaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaagccggcaagaaccctggcgacgctggctacatcgactacttcgca
ccgatcgtggctgacgccgaagccggtttcggcggcgtactgaacgcctacgagctgatg
aagagcatgatcgaagcaggcgccgccggcgttcacttcgaagaccagctggcttccgtg
aagaaatgcggccacatgggcggcaaggtactggttcctacccaggaagccgtgcagaag
ctgaccgctgcccgcctggcagctgacgtcgccggtactccgaccatcatcctggcccgt
accgacgccaacgccgctgacctgctgacgtccgactgcgacccgtacgaccagccattc
gtgactggcgaacgtacccaggaaggcttctacaaagtgcgcgccggtctggaccaggcc
atcgctcgcggcctggcctacgctccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaggctcgtcgcttcgctgaagcgatcaagaaggaatacccggaccaa
ctgctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgactgcctacgtgaagctgcaagagcaggaattcgctgacgccgccaagggttac
accttcgtggcccaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggtggctcatcttcggtaaccgcgctgaccggctcgactgaagaagaacagttc
cactga

DBGET integrated database retrieval system