KEGG   Pseudomonas sp. UW4: PputUW4_01867Help
Entry
PputUW4_01867     CDS       T02357                                 

Gene name
speB1
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PputUW4_01867 (speB1)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PputUW4_01867 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2195365..2196366
Genome map
AA seq 333 aa AA seqDB search
MSNNGYESGRLNLPFVGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRG
IREASTLFSFGHAGAYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKIL
DAGVMPVVLGGDHSVHAPVIKAFEGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASE
MNHIVGMTQMGIRNVSSSNRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNINYYIT
IDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPTGMT
SILAAQLLLNSIGFIFHERGKVRAAAESETTPA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaacggttatgaatccggtcgcctgaacctgccattcgtgggtcattgcacc
tttggcaaatccccggtgtgcaccgattgggacgcactggatgccgacgtcgcggtgctg
ggcgtgcccaacgacatgggcacccagtggcgctccggcgcacgcttcggaccccgcggt
attcgtgaagcatcgacgctgttttccttcggccacgccggcgcctacgatcacgaagat
gacgtgatgtacctcaccgcatcggatgtgcgcatggtcgacgtcggtgatgccgacatc
gtccacaccgacatggccaccagcaacaagaacactgaatacgccgtgcgcaagatcctc
gacgccggcgtgatgccggtggtgctcggcggcgaccactcggtgcacgcgccggtgatc
aaggccttcgaaggccgcggcccgatccacatcatccacttcgatgcgcacctggatttc
gtcgacgagcgccacggtgtgcgctacggccacggcaacccgctgcgccgtgcatccgaa
atgaaccacatcgtcggcatgacccagatgggcatccgcaacgtatcgtcgtccaaccgt
gacgattacgaagcggcccatgaagccggctcgaaaatcctctcggtacgtgacgtgcgc
cgcctcggcgtcgagggtgtgctggcgctgatcccgcagaacatcaactactacatcacc
atcgacatcgacggtttcgacccgtccatcgcccccggcaccggcaccccgagccacggc
ggcttcctctactacgaagtgctggaaatcatccaggccctggccaaacgcagcaagggc
aacatcgtcggtatggacctggtggaagtggcgccggtgtacgacccgaccggcatgacc
tcgatcctcgccgcgcaactgctgctcaacagcatcggtttcatcttccacgagcgcggc
aaggtgcgtgcggccgccgagagcgaaacaactccagcctga

DBGET integrated database retrieval system