KEGG   Pseudomonas sp. UW4: PputUW4_01878Help
Entry
PputUW4_01878     CDS       T02357                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PputUW4_01878
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputUW4_01878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205775..2206164
Genome map
AA seq 129 aa AA seqDB search
MKKIAALALALALSAGLFSTPTLAGGDVQAGEKVYKRLCSGCHQIGESARAFFGPQLNGV
IGRQSAVTTDYVYSDAMKSANLVWDRETLIAYLEAPKKVVPGTRMIFWGLSDPEKIEDLL
AYLQTFPAQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcgccgccctggccctcgccctggcactcagcgctggcctgttcagcaca
cccacccttgctgggggcgatgtccaggccggggagaaagtgtacaagcgcctctgcagc
ggctgccatcagatcggcgaatcggctcgcgctttcttcggcccgcagctcaatggcgtg
atcggccgccaatccgccgtcaccacggactatgtgtattccgacgcgatgaaatccgcc
aacctggtctgggatcgcgaaaccctgatcgcctaccttgaagcgccgaagaaagtggtg
cctggcacgcgcatgattttctggggcctcagtgacccggaaaaaatcgaagacctgttg
gcctatctgcaaacgtttccggcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system