KEGG   Pseudomonas sp. UW4: PputUW4_02363Help
Entry
PputUW4_02363     CDS       T02357                                 

Gene name
chlI
Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PputUW4_02363 (chlI)
Enzymes [BR:ppuu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PputUW4_02363 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2768449..2769456
Genome map
AA seq 335 aa AA seqDB search
MTDTPHFPLSAVVGADDLKLALYLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLARADGGVLYVDEVNLLPDHLVDLLLD
VAASGTNLVERDGISHRHSAKFVLIGTMNPEEGELRPQLLDRFGLNVALGGHTAPTERGQ
IIRRRLDFDSDPQGFCAEWESAQSSLRERCQHARNALASIPLDDQALARITERCFAAGVD
GLRADLVWLRAARAHAAWRGANAIAEEDIDAVAEFALRHRRREHSPPAPAQSQTVQQTAP
QNDNPSEGQGQWGELPAQALATGARREVPSWPKKP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccccgcatttcccgctctccgccgtggtcggcgccgatgatttgaagctg
gccctgtacctgaccgccatcgacccgaaaatcggcggagtcctgatcgaaggtccgcgc
ggcatggccaagtcgaccctggcccgtggtctggcggacttgctggccagcggtcagttc
gtcaccttgccgctgggcgccaccgaagagcgcctggttggcactctcgatctcgacgcg
gcgttgggcgaaggtcgcgcgcagttctcacccggcgtactggccagggctgacggtggc
gtgctctacgtcgacgaggtcaatctgttgcctgatcacctcgttgacttgctgctcgat
gtggccgccagcggcaccaatctggttgagcgtgacggcatttcccatcggcactcggcg
aagttcgtgctgattggcaccatgaatcccgaagagggtgaactgcgtccgcaactgctc
gaccgtttcggcttgaatgtcgcccttggtggccacacagcgccgaccgaacgaggccag
atcatccgtcgtcgcctggatttcgacagcgatccgcaaggattctgcgccgaatgggag
tcggcgcagtcatctctgcgcgaacgttgccagcacgcacgcaacgccctggcgagtatt
cctctcgacgaccaggcgctggcccggattaccgagcgctgctttgccgctggcgtcgat
ggtttgcgcgctgacctggtctggctgcgtgccgctcgggctcacgctgcctggcgcggg
gcgaacgctatcgccgaggaagatatcgacgccgttgccgagttcgccttgcgccatcgt
cgtcgcgagcattcgccgccggcacctgcgcaatctcaaactgtgcaacaaactgcgccg
cagaacgacaatccgagtgaagggcagggccagtggggcgaattgcctgcccaggcgctg
gcgaccggcgctcgacgtgaagtgccgagctggccaaaaaagccctag

DBGET integrated database retrieval system