KEGG   Pseudomonas sp. UW4: PputUW4_02411Help
Entry
PputUW4_02411     CDS       T02357                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PputUW4_02411 (galU)
   00052 Galactose metabolism
    PputUW4_02411 (galU)
   00500 Starch and sucrose metabolism
    PputUW4_02411 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PputUW4_02411 (galU)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PputUW4_02411 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2815176..2816015
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLKQMVKLYKQYRCTIVAIMEVDPQETSKYGVIAGDLIGD
DLYRVRNMVEKPKPEDAPSNLAIIGRYIMTPDIFSLIEQTEPGKGGEIQITDALMKQAQD
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggtactcgcttcctgccagcgact
aaagccatgcccaaagaaatgctgccggtggtgaacaagccactgatccagtacggcgtc
gaagaagcactggatgccggcttgaacgaaatctccatcgttacaggtcgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggagaaatacctggtcggcatccgtcgcctgctggatgagtgctcgttctcctacact
cgccagacagaaatgaaaggcctgggtcatgcgatcctgaccggtcgcccgctgatcggc
gacgagccgttcgccgtggtgttggcggatgacctgtgcgtcaacctggaaggtgacggc
gtactcaagcagatggtcaagctgtacaagcagtatcgctgcaccatcgtcgcgatcatg
gaagtggacccgcaggaaaccagcaagtacggcgtgattgcaggcgacctgattggtgac
gacctgtaccgcgtgcgcaacatggtcgagaaaccaaagccggaagatgccccgtcgaac
ctggcgatcatcggtcgttacatcatgacgccggacatcttcagcctgatcgaacaaacc
gagccaggcaaaggcggcgaaatccagatcactgacgccctgatgaaacaggcgcaggat
ggatgcgtgattgcctacaagttcaaaggcaagcgtttcgactgcggtggcgctgaaggc
tacatcgacgcgaccaacttctgcttcgagaacttctacaagacgggcaaggcttattga

DBGET integrated database retrieval system