KEGG   Pseudomonas sp. UW4: PputUW4_02471Help
Entry
PputUW4_02471     CDS       T02357                                 

Gene name
speB2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppuu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2883802..2884761
Genome map
AA seq 319 aa AA seqDB search
MDVPMQNDQALTRDSLYGTAAESTYAGITSFMRRRYSRDLRGVDVAVSGVPFDTATSNRP
GARFGPRGIRAASAGIAWERHWPWTFDPFDHLAVIDYGDCNFDYGSPQSTPECIEAHAEH
ILNAGTAMLTFGGDHFITYPLLKAHARKHGALSLIHFDAHSDTWPDEEGKRIDHGTMFWH
AAREGLVDPSRSVQIGLRTTNDDHQGFQVLDARQVHRRGCEAIVEAIRARVGDNPVYLTF
DIDCLDPAFAPGTGTPVCGGLSAVQALEILGGLRGINLVGMDVVEVAPAYDSAEITSLAA
ATLAMEMLCLYAARHKVDK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcccgatgcagaacgatcaagcccttacccgtgacagcctctatggcacggcc
gccgaaagtacctacgccggtatcaccagtttcatgcgtcgccgctacagccgtgacttg
cgcggggtcgacgtggcggtcagcggtgtacccttcgacaccgccaccagcaaccgcccc
ggcgcacgcttcggaccacggggcattcgcgccgcctccgccggtatcgcctgggaacgg
cactggccgtggaccttcgacccgttcgaccatctggcggtgatcgactacggcgattgc
aatttcgattacggttcgccgcaatcgacgccggaatgcatcgaggcccacgccgagcac
atcctcaatgccggcacggcgatgctgacctttggcggcgaccatttcatcacctatccg
ctgctcaaggcccatgcccgcaagcacggggcattgtcgctgatccacttcgacgcccac
agcgacacctggccggacgaagagggcaagcgtatcgaccacggcaccatgttctggcac
gcggccagggaaggactggtggatccgtcacgctcggtgcagatcggcttgcgcaccacc
aacgacgatcaccagggctttcaagtgctggatgcgcgacaggtgcatcgccgtggctgc
gaagcgattgtcgaggcgattcgcgcgcgggtcggcgataacccggtgtacctgaccttc
gacatcgactgcctcgatccggcattcgctccgggtaccggaacaccggtgtgcggcggc
ctgagcgcggtgcaggcgctggagatcctcggcggcctgcgcggaatcaatctggtgggc
atggacgtggtggaagtggcgccggcctatgacagtgcggagatcacctcattggcggcg
gcgacattggcgatggagatgctgtgtctgtatgcggccaggcataaggttgataagtag

DBGET integrated database retrieval system