KEGG   Pseudomonas sp. UW4: PputUW4_02523Help
Entry
PputUW4_02523     CDS       T02357                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppuu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppuu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2936356..2936949
Genome map
AA seq 197 aa AA seqDB search
MNSATSLPAIEAIVIGASAGGVEALLNILGPLREGFVLPIIVVLHLPDERRSQLADVFAR
RVAMPVLEACDKTAVEAGTLYFAAPGYHLSVERDRSFSLSLEPRVHHSRPAIDYLFESAA
DAYGAGLAAVLLTGANRDGAHGLAQVKQRGGITIVQDPQEAQVATMPQAALDMHRPDHIL
SVRGIGRLLVEMERIAC
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcaacgagcctgccagctatcgaagcgatcgtgatcggtgcctccgccggt
ggcgttgaggcgctgttgaacatcctcggaccgctgcgcgaaggatttgtgttgccgatc
attgtcgtgctgcacctgccggacgaacgccgcagccagctggcggatgtgtttgcccgc
cgggtggccatgccggtgctggaggcgtgcgacaagactgcggtcgaggccggcacgctg
tatttcgcagcgcccggttatcacctgtcggtggagcgggaccgtagcttttccctgagc
ctggagcctcgagtgcatcattcgcgtcccgccatcgattacctgttcgagtcggctgcc
gatgcctacggcgccgggctggctgcagtcctgctcacaggcgccaaccgcgatggcgcg
cacgggctggcccaggtcaaacagcgcggtggcatcaccatcgtgcaagacccgcaagag
gctcaggtcgccaccatgccccaggctgcgctggatatgcaccggccagaccacatactt
tctgtacgcggcatcggccgtctgcttgtcgagatggaacgaatcgcatgctga

DBGET integrated database retrieval system