KEGG   Pseudomonas sp. UW4: PputUW4_02646Help
Entry
PputUW4_02646     CDS       T02357                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00260  Glycine, serine and threonine metabolism
ppuu00750  Vitamin B6 metabolism
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01230  Biosynthesis of amino acids
Module
ppuu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputUW4_02646
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PputUW4_02646
Enzymes [BR:ppuu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PputUW4_02646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFY19841
UniProt: K9NIE7
Position
complement(3097905..3099293)
Genome map
AA seq 462 aa AA seqDB search
MDYVSTRGGDMRADFRSVVLSGLAENGGLYVPASLPVFTEKQIASWSWLPFDELVWRVIS
PFVGSSIDESTLRGLLSDSYRQFKHRAITPLEQIGHNEWILQLFHGPTRSSKDFAAQLQS
RLVKHFLEEVGKEALVVGATNGDTGLAALEAFTDCPAARMAILYPRDGLAPEQLSVLQAA
DPQRVQLFAVDGNFDDCQMLVSRLLREWPLGAVMPICFNSTNWIGVLAQIVFYFHAALQL
GGGSRPVGFSVPAASSAEIYAGYIAQKMGLPINQVIISTNSNDALHQFFHCNRYSTRMTD
RTVSPAMDFSLFSNLERFIWEIYEHDGCSTKALMEHFESCGEMSIGNQQWLRARVLFDSY
AVDESQVRDEVVELFRETGSAIDPHTAVGVLAGRLHRRSLGAPMVTFGQIAPAKSAALLA
ELGVWQASVPSTVEVSAQPPYLAKGDLDGLCQALCLAQQRLV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggattatgtaagcacacgcggcggtgacatgcgggcagattttcgcagtgtggttctg
tcggggctcgccgaaaacggtggtctctatgtcccagccagtttgccggtattcactgag
aaacagattgccagctggtcgtggctgccgtttgatgagttggtttggcgagtgatttcg
ccttttgttggctcttccatagatgaaagtaccctgcgtggcttgctcagtgacagctat
cgacaattcaagcatcgcgccattacgccgcttgagcagatagggcataacgagtggata
ctccagctgtttcatggcccgacccgttcttccaaggatttcgccgcgcaattgcagtcg
cgcctggtcaagcattttcttgaggaggtcggtaaagaagcgttggtggtcggtgcaact
aacggtgataccggccttgctgcgcttgaagcctttactgactgcccggccgcccgcatg
gcgatactgtatccgcgcgatggtcttgcgcctgagcaactcagtgtcttgcaggcagcc
gacccgcagcgggtccagctgtttgcggttgacggtaatttcgatgattgccagatgctg
gtctcccgactattgcgtgagtggccattgggcgcagtgatgccgatctgtttcaactcg
accaattggatcggtgtcctggcccagatcgttttttacttccacgcggccttgcaactg
ggcggtggctcgcgtcccgtcggctttagcgttccagcggccagctcggccgaaatctac
gccggctacattgcgcagaaaatgggattacccatcaatcaggtgatcatatcgaccaac
agcaatgatgccctgcaccagttttttcattgcaatcgctactccacccggatgactgat
cgaacagtgtcaccggcgatggacttctcgttgttttccaacctggagcggtttatctgg
gagatttacgagcacgatggctgctcgacaaaagcgctgatggagcattttgaaagttgc
ggagaaatgagcatcggaaaccagcaatggctgcgtgcccgagtgctcttcgattcctat
gcggtagacgaatcccaggtgcgcgatgaggtcgtcgaactgttccgcgagacgggctcg
gccatcgatcctcacaccgctgtcggtgtactggctggcaggcttcatcgacgcagcctg
ggcgcgccgatggtcaccttcgggcaaattgcgccggccaagtcggcggcgctgttggcc
gagctgggcgtctggcaagcaagcgttccgagcactgtcgaggtgagcgcgcaaccaccg
tacctggccaagggcgatctggacggtctgtgccaggccctttgtctggcgcagcagagg
cttgtatga

DBGET integrated database retrieval system