KEGG   Pseudomonas sp. UW4: PputUW4_02791Help
Entry
PputUW4_02791     CDS       T02357                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputUW4_02791 (malQ)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PputUW4_02791 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3257715..3259793
Genome map
AA seq 692 aa AA seqDB search
MSDAQLEILASRAGLAVDWIDANGRPQKVAPSVLRNVLTGLGHPAGSAQEIDASLLELQA
VQQTHHLPPLITADVGVGLDLARYFAPETPCEIHLEDGSRLNLKLDANAKLPGLVPVGYQ
QVSIDGQTFTLAVAPLRCYSVGDAVDNPIPRAWGLSVQLYALRRPGDGGFGDTQALEDLA
RVAGERGAEALAISPLHAMFSNDAQRYSPYSPSSRLFLNSLYCAPGTILGERALRTAIDA
TGLAIELKALEERPLIDWPAAAEAKHRLLQSLYEGFVQGEHPLHEDFSSFRHAAGEALEN
HCRFEAIQEARAARGEGLDWRLWPEPWRNPRSAELAAFAEENAGRIGFFAFCQWLITRCL
ERAQTAARASGMSIGLIADLAVGADGGGSQAWSRQDELLASLTVGAPPDILNRTGQGWGI
SAFSPEGLVRNGFRAFIEMLRANFAHCGGLRIDHVMGLQRLWVIPNGSPPADGAYLYYPV
DDLLRLLTLESHRHQAIVLGEDLGTVPDGLREKLIARSMLGMRVLLFEQDNTHFKPILDW
PDNALATTSTHDLPTLNGWWHGRDIDWNARLGMIDASGEIEWRQHREREREGLRRALSQD
PQNFREESHETDQVLDASVRFLGHTRAPLVLLPLEDALGVEQQANLPGTIDTHPNWSRRL
PGYSEALLDGPDAARRLELLACARLQAAERDR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgcgcaactggaaattctggccagccgtgccggcctcgcagtcgactggatc
gacgccaacggccgcccgcaaaaagtcgcgccttccgtgttgcgaaatgtgctgactggc
ctcggtcacccggcgggcagtgcccaggaaatcgacgccagcctgttggaattgcaagcg
gtgcagcagacccaccacttgccgccattgatcaccgccgatgttggagttggcctggat
ctggcgcgttattttgcacctgaaaccccttgcgaaatccacctcgaagacggttcgcgg
ctcaacctcaagctggacgccaacgcaaagctgccggggctggtaccggtcggctatcaa
caggtcagtatcgacggacaaaccttcaccctggcggtggccccactccgttgttacagc
gttggcgatgccgtggataacccgatcccccgtgcctggggcctgagcgtgcagttgtat
gcgttacgccgccccggcgatggcgggtttggtgacacccaggcgctggaggacctcgcc
cgagtggccggtgaacgtggcgccgaggcgctggcgatcagccccttgcatgcaatgttt
tccaatgacgcccaacgctatagcccgtactcgccctccagccgtttgtttctcaacagc
ctttactgcgcccccggcaccattctcggcgagcgcgccctgcgcaccgcgatcgatgca
accgggctggccattgaactcaaggcgctggaagagcgtccgctgattgactggccggcc
gccgccgaagccaagcatcggctgttgcagtcgctgtacgaaggtttcgtccagggtgaa
caccccttgcacgaagacttcagcagttttcgtcacgccgccggcgaagcgctggaaaac
cactgtcgcttcgaagccatacaggaggcacgcgctgcccggggtgaaggcctcgactgg
cgactgtggcccgaaccctggcgtaatccgcgaagcgctgaactggcggcattcgccgaa
gagaatgccgggcgcatcggcttcttcgccttctgccagtggctgatcacccgctgcctg
gaacgcgcgcaaaccgccgcccgcgccagcggcatgagcatcggcctgatcgccgacctg
gccgttggtgccgatggtggcggcagccaggcctggagccggcaggatgaactgctcgcg
tccctcaccgtcggtgcgccaccggatattctcaaccgcacgggccagggctgggggatt
tccgcgttctcccctgaaggcctggtgcgcaatggtttccgggctttcatcgaaatgctg
cgggccaatttcgcccactgcggtggcttgcgtatcgatcacgtcatggggctgcagcgg
ctgtgggtgatccccaacggctcgccgccggccgacggcgcctacctgtattacccggtg
gacgacctgttgcgcttgttgaccctggaatcccatcggcaccaggccatcgtcctcggc
gaagacctcggcaccgtgccggacggcctgcgggaaaaactcatcgcccgttcgatgctc
ggcatgcgggtgctgctgttcgagcaggacaacacgcacttcaagccgatcctcgactgg
ccggacaacgccctggcgaccaccagcacccatgacctgccgaccctcaacggctggtgg
catggtcgcgatatcgactggaacgcccggctcggcatgatcgacgccagcggtgagatc
gaatggcgccagcatcgcgagcgcgagcgcgagggcctgcgccgggcgttgagccaggac
ccgcagaacttccgcgaagaatcccacgaaaccgaccaggtgctcgatgccagcgtgcgt
tttctcgggcatacccgggcacccttggtgctgctgccgctggaagatgcccttggcgtg
gaacaacaggccaacctgcccggcaccatcgacacccacccgaactggtcgcggcgcttg
cccggctacagcgaggccctgctcgatggaccggatgccgcgcggcgcctggaactgctc
gcctgtgcgcgactgcaggcggccgagcgtgaccgatga

DBGET integrated database retrieval system