KEGG   Pseudomonas sp. UW4: PputUW4_02799Help
Entry
PputUW4_02799     CDS       T02357                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppuu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3273405..3275636)
Genome map
AA seq 743 aa AA seqDB search
MSVSNKEQGHHKEALLPGARDIDALVRAEHIDPFAILGPHGDGAGGQFIRAYLPGALSVE
VLARDSGEALGSLQATETPGLFVGHFDRAQAYLLRTRWAGGEQTAEDPYSFGPLLGDMDL
YLFAEGNHRDLSACLGAQLKTVDGVDGVRFAVWAPNARRVSVVGDFNVWDGRRHPMRLRH
PTGVWELFIPRLQAGDAYKYEILGAHGILPLKADPMALATSLPPDTASKVASPLNVDWQD
QDWMLSRGDHQRVTAPLSIYELHAGSWQCELDDLGEVARQYTWPELTERLIPYVKDLGFT
HIELMPIMEHPFGGSWGYQLLSQFAPSARYGTPDQFAAFVNACHQAGIGVILDWVPAHFP
TDTHGLAQFDGTALYEYGNPQEGFHQDWDTLIYNLGRTEVHGYMLASALHWLKHFHVDGL
RVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALEAPGALVIAEESTA
WPGVSQGTQQGGLGFAYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFILP
ISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWAHPGKKLLFMGCEFGQWREWNHDQ
QLDWYLLQYSEHKGVQKLVGDLNRLYREEPALHEQDDVPQGFQWLIGDDAINSVYAWLRW
SKEGKPVLVVANFTPVPREAYRVGVPFAGQWNEVLNSDSSIYAGSNYGNSGGAMAEETPS
HGQALSLVLNLPPLAVLMLRPET
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctcgaacaaggaacagggtcatcacaaagaagcgctgctgcctggcgcacgg
gatatcgatgcattggtgcgtgccgagcatatcgatcccttcgccatacttggcccccac
ggtgatggcgccggtggacagttcatccgcgcctacctgccgggcgccctgagtgtagaa
gttctggcccgggattcgggtgaagcgcttgggagtcttcaagccacagagacgccgggg
ttgtttgtcgggcatttcgaccgcgcgcaagcgtatctgctgcgcacccgttgggccggt
ggcgagcagacggccgaagacccttacagcttcggcccattgctgggcgacatggatttg
tacctgtttgccgaaggcaatcaccgcgacctcagtgcgtgcctcggtgcccagctcaag
accgtggacggtgtcgacggtgtacgtttcgcggtgtgggcacccaatgcccggcgggtg
tcggtggtgggtgatttcaacgtctgggacgggcgccgccatccgatgcgcctgcgacat
cccaccggggtctgggagttgttcatcccgcgcctgcaagcaggggacgcctacaagtac
gaaattctcggtgcccacggcatcctgccactgaaggccgacccgatggcgctggccacc
agtctgccaccggacaccgcctcgaaagtcgcctcacctttgaacgtcgactggcaggat
caggactggatgctgtcccgtggcgaccaccagcgggtgacggcgcccttgtcgatctac
gaattgcacgccggttcgtggcaatgcgagctggacgacctgggtgaagtggcccgccag
tacacctggccggaactgaccgaacgactgattccctatgtcaaagacctgggcttcacc
cacatcgaactgatgccgatcatggagcacccgttcggcggttcgtggggttatcagttg
ctgtcgcaattcgcgccgagtgcgcgttatggcacgccggaccagttcgccgcgttcgtc
aacgcctgccaccaggccggcatcggggtgattctcgactgggtgccggcgcatttcccc
accgatacccacggcctcgcccagttcgacggcacggccctgtacgagtacggcaacccg
caggaaggcttccaccaggattgggacacgctgatctacaacctggggcgcaccgaagtg
cacggctacatgctggcgtcggcgctgcactggctcaagcacttccacgtcgatggcctg
cgggtcgatgccgtggcctcgatgctgtaccgcgactactcgcgcaaagccggcgagtgg
gtgccgaaccgccatggcgggcgggagaacctggaagccatcgacttcctgcgccacctc
aacgatgtggtcgccctggaagcacccggtgcgttggtgatcgccgaggaatccaccgca
tggccaggcgtcagccagggcacgcaacagggtggcctgggctttgcgtacaaatggaac
atgggctggatgcacgattcgctgcattacatccagcaggacccggtgtaccgcgcccat
caccacaacgagctgagttttggcctggtgtacgcctggtccgagcgcttcatcctgccg
atctcccacgacgaagtggtacacggcaagcactcgctgatcgacaaaatgcccggagac
cgctggcagaaatttgccaacctgcgggcctacctgagtttcatgtgggcgcacccgggc
aagaaactgctgttcatgggctgcgagttcggccaatggcgcgagtggaaccacgaccag
caactggactggtacttgctccagtactccgagcacaagggcgtacagaaactggtcggc
gacctcaatcgcctgtaccgcgaagaaccggcgctgcatgagcaggacgatgtgccgcag
ggtttccagtggctgatcggcgatgacgcgatcaacagcgtttatgcgtggctgcgctgg
agcaaggaaggcaagccggtgctggtggtggccaactttacgccggtgccgcgtgaggcg
tatcgcgtcggggtgccgtttgccgggcagtggaatgaggtgctcaacagcgactcgtcc
atctatgccggttccaattacggcaatagtggcggggcaatggccgaggaaacgccgagc
catgggcaggcgttgtcgttggtgttgaatttgccgccgctggcggtgttgatgttgcgg
ccggagacttaa

DBGET integrated database retrieval system