KEGG   Pseudomonas sp. UW4: PputUW4_03021Help
Entry
PputUW4_03021     CDS       T02357                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PputUW4_03021
Enzymes [BR:ppuu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PputUW4_03021
Transporters [BR:ppuu02000]
 Other Transporters
  Pores ion channels [TC:1]
   PputUW4_03021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFY20216
UniProt: K9NJI7
Position
3550315..3550977
Genome map
AA seq 220 aa AA seqDB search
MSLTLYFHPLSSFCHKALIALYELDIEFEKRVIDLGNDADRGELQALWPIGKFPVLRDHT
RQKNVPESSVIIEYLDRLHAGQAHLIPHDWEAALEVRLWDRFFDLHVQVPMQKIVADRLN
AANGDLTRERAALTTAYGLLERQLTARTWVASPAFSMADCAAAPALFYASTLVPFADDHR
HLRAYLDRLTERPSVKRVIDEARPWFAWYPFAEAIPERFR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgactctttatttccacccgctctcgtcgttctgccacaaagcactgatcgcc
ctctatgaactggacatcgagtttgaaaaaagggttatcgacctgggcaacgacgccgac
cggggcgaacttcaagcgctgtggccgatcggcaagttcccggtgcttcgcgatcacacc
cggcaaaagaacgtgccggagtcgagtgtgatcattgaatatctggaccggctccatgcc
ggccaggcgcacctgattccccacgattgggaagccgccctggaagtgcggctgtgggat
cgctttttcgacctccacgtccaggtgccgatgcagaagatcgtcgctgaccgcctgaac
gccgccaacggcgacctgacccgcgagcgcgccgcgctgacaacggcgtacggcctgctt
gaacggcaactgacggcacgaacctgggtggccagtccggcattcagcatggccgattgc
gccgccgccccggcgctgttctacgccagcaccctcgtcccctttgccgacgatcatcgc
cacttgcgcgcttatctcgacaggttgaccgaaaggccctcggtcaagcgggtgatcgac
gaggcaaggccctggtttgcctggtatccgtttgccgaggccatcccggagcgctttcgc
tag

DBGET integrated database retrieval system