KEGG   Pseudomonas sp. UW4: PputUW4_03021Help
Entry
PputUW4_03021     CDS       T02357                                 

Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppuu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3550315..3550977
Genome map
AA seq 220 aa AA seqDB search
MSLTLYFHPLSSFCHKALIALYELDIEFEKRVIDLGNDADRGELQALWPIGKFPVLRDHT
RQKNVPESSVIIEYLDRLHAGQAHLIPHDWEAALEVRLWDRFFDLHVQVPMQKIVADRLN
AANGDLTRERAALTTAYGLLERQLTARTWVASPAFSMADCAAAPALFYASTLVPFADDHR
HLRAYLDRLTERPSVKRVIDEARPWFAWYPFAEAIPERFR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgactctttatttccacccgctctcgtcgttctgccacaaagcactgatcgcc
ctctatgaactggacatcgagtttgaaaaaagggttatcgacctgggcaacgacgccgac
cggggcgaacttcaagcgctgtggccgatcggcaagttcccggtgcttcgcgatcacacc
cggcaaaagaacgtgccggagtcgagtgtgatcattgaatatctggaccggctccatgcc
ggccaggcgcacctgattccccacgattgggaagccgccctggaagtgcggctgtgggat
cgctttttcgacctccacgtccaggtgccgatgcagaagatcgtcgctgaccgcctgaac
gccgccaacggcgacctgacccgcgagcgcgccgcgctgacaacggcgtacggcctgctt
gaacggcaactgacggcacgaacctgggtggccagtccggcattcagcatggccgattgc
gccgccgccccggcgctgttctacgccagcaccctcgtcccctttgccgacgatcatcgc
cacttgcgcgcttatctcgacaggttgaccgaaaggccctcggtcaagcgggtgatcgac
gaggcaaggccctggtttgcctggtatccgtttgccgaggccatcccggagcgctttcgc
tag

DBGET integrated database retrieval system