KEGG   Pseudomonas sp. UW4: PputUW4_03155Help
Entry
PputUW4_03155     CDS       T02357                                 

Definition
(GenBank) diguanylate cyclase (EC:2.7.7.65)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppuu  Pseudomonas sp. UW4
Brite
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PputUW4_03155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3697586..3698653)
Genome map
AA seq 355 aa AA seqDB search
MSQSDTRATVLALYPEDSREAAALLKQAVPLMVRHNIPPNPVHYALWYTYSKGQEPELNR
HLDRVVNDFDSFPPESAAKLFREYIIRDELADARSGQQEAINLVDDMERDVSRSVKGNQN
FQASLGQYLQMLEEPATERLPSILIQLQQSTQLMQSQQEHFLSQLQSAQHEIKSLRDKLE
RAQLAATLDGLTELLNRSTFNRKFEQAMNDAASGLALVMLDIDHFKQFNDQYGHPLGDRV
LQHVARVLRESLSGEAFAARYGGEEFCVVLKDCPDLAAAGAFAERLRLKIQSLRVKARGT
DTVLDTITASFGVAHAQPGDTPESLLTRADDALYQAKRNGRNQVRQQPDVPVAAG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatccgacacgcgtgcgactgttctagcgctgtatccagaagattcccgtgag
gcagcggcgttgctcaagcaggcagtgccgctgatggttcgtcacaacattccgcccaat
ccggtgcactacgcgctctggtacacctatagcaagggccaggagccggagctcaatcgg
cacctggaccgggtggtcaacgatttcgactctttcccgccggagtcggccgccaagctg
tttcgcgaatacatcatccgcgacgaactggcggacgcccgttccgggcagcaggaagcg
atcaacctggtcgacgacatggagcgtgatgtttcgcgcagcgtgaagggtaaccagaac
ttccaggccagccttggccagtacttgcaaatgctcgaagaaccggccactgaacgcttg
ccgagcatcctgatccagctgcaacagagcacccagctgatgcagagccagcaggaacat
ttcctctcccagttgcagtctgcgcagcatgaaatcaaaagcctgcgcgacaagctggaa
cgtgcccaactggctgcgaccctcgatggcctgaccgaattgctcaaccgcagcaccttc
aaccgcaagtttgaacaggcgatgaatgacgcagcgtccggcctggcgctggtgatgctg
gatatcgaccacttcaagcaattcaacgatcagtacggccatccattgggggatcgtgtt
ctccagcatgttgcccgggtgttgcgtgaatcgctgtctggcgaagcgttcgcggcacgc
tacggcggcgaggagttctgcgtggtgctcaaggattgcccggatctggcggcggcgggt
gcatttgccgagcgcctgcgcctgaaaatccagtcgctgcgggtcaaggcccggggcacc
gataccgtgctggataccatcactgcgtcgttcggcgtggcccatgcacaacccggcgac
acgccggaaagcctgctgacccgcgccgacgatgcgctgtaccaggccaagcgcaacggg
cgcaaccaggtacgtcagcagccggacgtaccggtcgcggccggttaa

DBGET integrated database retrieval system