KEGG   Pseudomonas sp. UW4: PputUW4_03398Help
Entry
PputUW4_03398     CDS       T02357                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PputUW4_03398 (rbsK)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PputUW4_03398 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3955396..3956313)
Genome map
AA seq 305 aa AA seqDB search
MPAKVVVIGSLNMDLVTRAPRLPKGGETLIGHSFATVSGGKGANQAVAAARLGAQVSMIG
CVGNDAYGEALRGALLAEQIDCQAVSTIDGSSGVALIVVDDSSQNTIVIVPGANGALTAE
AIDRFDSVIQAADVLICQLEVPDASVGHALKRGRELGKTVILNPAPASRPLPSHWYGSID
YLIPNESEASALSGLSVDSLETAQAAATRLIALGAGKVIITLGAQGSLFADGQRFEHFPA
PVVKAVDTTAAGDTFVGGFAAALAAGQDEVQAIRFGQVAAALSVTRAGAQPSIPALSDVQ
AFKTP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtagtggtaataggcagtttgaacatggacctggtgacccgggcgccg
cgtttgcccaagggcggtgaaacgctgattggtcattcgtttgccaccgtctccggcggc
aagggcgccaatcaggctgtggctgcggcacggctcggagcccaggtgtcgatgatcggt
tgtgtgggcaatgacgcctatggtgaggcgttgcgcggggcgctgttggccgagcagatc
gattgccaggcggtgagcaccattgacggttccagcggcgtggcattgattgtggtcgac
gacagcagtcagaacaccatcgtgatcgtccctggtgccaacggtgcattgaccgctgaa
gccattgaccgttttgattcggtgatacaagcggcggacgtactcatctgccagctggaa
gtgcccgatgcctccgttggtcatgcactcaagcgggggcgcgagctgggcaagacggtc
atcctcaacccggcgccggccagccgtccgttgccatcgcactggtacgggtctatcgat
tacctgattcccaacgagagcgaggcgtcggccttgagcggtctgtcggtggactccctg
gagaccgcgcaagccgcggcgacccggctgattgccctgggtgctggcaaggtgatcatc
accctcggtgcgcaaggttcgctgtttgccgatggccagcgattcgagcatttccccgcg
cccgtcgtaaaggctgtcgacaccacggcggcgggcgatacgttcgtcggtggtttcgct
gcggcgttggctgcgggtcaggatgaagtgcaggcgatccgcttcgggcaggtggctgcg
gcgctgtcggtcacccgtgccggcgcgcaaccttcgattcccgccttgagcgatgtgcag
gcgtttaaaactccatga

DBGET integrated database retrieval system