KEGG   Pseudomonas sp. UW4: PputUW4_03514Help
Entry
PputUW4_03514     CDS       T02357                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PputUW4_03514 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PputUW4_03514 (nagZ)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PputUW4_03514 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4082791..4083801)
Genome map
AA seq 336 aa AA seqDB search
MTAGLQGSLMVDVAGTWLTAEDRQLLRQPEVGGLIIFARNIEHPRQVRELSAAIRAIRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRAIADNPNAEYLAEQCGWIMATEVLAVGLDLSFAP
VLDLDYQRSAVVGTRSFEGDPERAALLAGAFIRGMNSAGMAATGKHFPGHGWAEADSHVA
IPNDERSLDEIRANDLVPFAKLSKQLAAIMPAHVIYPQVDSQPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALSAAQRLKVKPS
ERIARMRGQSFASTEYRQDPRWLAAVGALKEAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggcttgcaaggctcgttgatggtggacgtcgccggtacctggctgacggct
gaagatcgccaattgttgcgccagcccgaagtgggcggcctgatcatttttgcccgtaac
attgagcatccgcgtcaagtgcgcgagctgagtgcagcgattcgcgccattcgccccgat
ctgctgttggcggtggatcaagagggcggccgcgtgcagcgcctgcgccagggtttcgtg
cgcctgcccgccatgcgtgccattgccgacaacccgaacgccgaatacctggccgagcag
tgcggctggatcatggcgaccgaagtgctggccgttggcctggacctgagtttcgccccg
gtgctcgacctcgattaccagcgcagcgccgttgtcggcacccgttcgttcgaaggtgat
cccgagcgcgctgccttgctcgcgggtgcattcatccgcgggatgaacagcgcagggatg
gccgctaccggcaagcacttcccgggtcacggctgggccgaggccgattcccacgtcgcg
atccccaacgacgaacgcagcctcgacgaaatccgcgccaacgacctggtgccgtttgcc
aaattgagcaagcaactggccgcgatcatgccggcccacgtcatttatccacaggtcgac
tcccagcccgcaggcttctcccgccgctggttgcaggacatcctgcgcggcgagttgcag
ttcgatggcgtgatcttcagcgacgacctgtccatggctggcgcccacgtggtcggcgat
gccgccagccgtatcgaagcggcgctgacggccggttgcgacatgggcctggtgtgcaac
gatcgcgctgccgccgaattggccctgagcgctgcgcaacgcctgaaggtcaagccttcc
gagcgcattgcgcggatgcgcggccagtcgtttgccagcaccgaataccgtcaagacccg
cgctggctggccgctgtcggcgcgctcaaagaagctcaattgattgattaa

DBGET integrated database retrieval system