KEGG   Pseudomonas sp. UW4: PputUW4_03683Help
Entry
PputUW4_03683     CDS       T02357                                 

Gene name
fadJ
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase/short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00071  Fatty acid degradation
ppuu00280  Valine, leucine and isoleucine degradation
ppuu00281  Geraniol degradation
ppuu00310  Lysine degradation
ppuu00362  Benzoate degradation
ppuu00380  Tryptophan metabolism
ppuu00410  beta-Alanine metabolism
ppuu00640  Propanoate metabolism
ppuu00650  Butanoate metabolism
ppuu00903  Limonene and pinene degradation
ppuu00930  Caprolactam degradation
ppuu01040  Biosynthesis of unsaturated fatty acids
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
ppuu01200  Carbon metabolism
ppuu01212  Fatty acid metabolism
Module
ppuu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputUW4_03683 (fadJ)
   00650 Butanoate metabolism
    PputUW4_03683 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PputUW4_03683 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PputUW4_03683 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputUW4_03683 (fadJ)
   00310 Lysine degradation
    PputUW4_03683 (fadJ)
   00380 Tryptophan metabolism
    PputUW4_03683 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputUW4_03683 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputUW4_03683 (fadJ)
   00281 Geraniol degradation
    PputUW4_03683 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputUW4_03683 (fadJ)
   00930 Caprolactam degradation
    PputUW4_03683 (fadJ)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PputUW4_03683 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputUW4_03683 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PputUW4_03683 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFY20875
UniProt: K9NNQ7
Position
complement(4276130..4278274)
Genome map
AA seq 714 aa AA seqDB search
MSEAIRYEKDQDRIVVLTIDLPDQSANTMNAVYREAMADCVARLVGDKDNIAGVIITSAK
KTFFAGGDLNELIKVGKPEAKAFYDMVLTLKGQLRTLETLGKPVVAAINGAALGGGWEIC
LACHHRVALDNPAVQLGLPEVTLGLLPGGGGVVRMVRMLGIEKALPYLLEGKKVRPQQAL
QAGLIDALATDREDLLAKARAWILANPVAVQRWDVKGYQIPGGTPSSPKVAQMLAIAPSI
LRSKTQGTMPAPEKILCAAVEGAQVDFDTAHLIETRYFTELTTGQVSKNLIGTFWFQLNE
INAGGSRPQGFAPYVTRKVGVLGAGMMGAGIAFVSASAGIDVVLKDINLAAAEKGKAHSA
ALLDKKVARGQMSIEQRDAVLARIQTSENDADLAGCDLIIEAVFEDRDLKAKVSLAAQKV
VGADAVIASNTSTLPISGLACAVPDQSKFIGLHFFSPVEKMPLVEIIKGANTSDETLARG
FDYVLQIRKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVNAAMIETEARKAGMPVGPL
AISDEVSLSLMSHIRLQTAKDLQAEGKPLTEHPAFAVIDLLLNEFKRPGKAAGGGFYEYP
VGGQKYLWPELKKRFEKADGQISPVDVRDRLLFVQAIETVRCVEEGVLTSTADANVGSIF
GIGFAAWTGGALQFINQYGVQDFVARAQYLAKQYGERFAPPALLLEKAAKGEAF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccattcgttacgaaaaagaccaggaccgcattgtcgtcctgaccatagac
ctgccggaccagagcgccaacaccatgaacgcggtgtaccgcgaggccatggccgactgc
gtcgcgcgcctggtgggtgacaaggacaacatcgccggtgtgatcatcacttcggccaag
aaaaccttctttgccggtggcgacctcaatgaattgatcaaggtcggcaagcccgaagcc
aaagccttctacgacatggtgctgaccctcaaggggcagttgcgcaccctggaaaccctg
ggcaaaccggtggttgcggcgatcaacggcgcggcactcggcggcggctgggaaatctgc
ctggcctgccaccatcgggtggcgctggataatcctgcggtgcaactcggcctgccggaa
gtcaccctcggcctgctgccgggcggtggtggcgtggtgcgcatggtgcgtatgctcggg
atcgaaaaagccctgccgtacctgctggaaggcaagaaggtgcggccgcaacaggcattg
caggcaggcctgatcgacgctttggcaaccgaccgcgaagatctgttggccaaggcgcgg
gcgtggattctcgccaacccggtggcggtacaacgctgggacgtgaagggctatcagatt
ccgggcggtacaccgtcaagcccgaaagtcgcccagatgctggcgattgccccgtctatc
ctgcgcagcaaaacccagggcacgatgcccgcgccggagaaaatcctctgcgcagcggtc
gagggcgcgcaggtggatttcgacaccgcgcacctgatcgaaacccgctactttaccgaa
ctgaccaccggccaggtctcgaaaaacctgatcggcacgttctggttccagctcaacgaa
atcaacgccggtggctcgaggccgcaaggttttgcgccttatgtcacccgcaaggtcggc
gtgctcggcgccgggatgatgggcgccggtattgcgtttgtcagcgcgtcggcgggtatc
gatgtggtactcaaggacatcaatctcgccgcagccgagaagggcaaggcgcattcggca
gcgctgctggacaagaaagtcgctcgcggacaaatgagcatcgagcaacgtgatgcggtg
ctggcgcgcatccaaaccagcgaaaacgatgctgacctggccggttgcgacctgatcatc
gaggcggtgttcgaggatcgtgacctcaaggccaaagtctcgttggccgcgcagaaggtc
gtcggcgcggacgcggtgatcgcgtccaacacctcgaccttgccgatcagcggcctggcg
tgcgccgtgcccgatcagagcaagttcatcggcctgcattttttcagccccgtggaaaaa
atgccgctggtggaaatcatcaagggtgccaataccagcgacgaaaccctggcccgcgga
ttcgattacgtcctgcaaatcaggaagaccccgattgtggtcaacgacagccgcggtttc
ttcacgtcgcgggtgttcggcaccttcaccaacgaaggcattgccatgctgggcgaaggt
gtgaacgcggcgatgatcgagactgaagcacgcaaggccggcatgcctgtaggaccgctg
gcgatctctgatgaagtttccctcagcctgatgagccatatccgcctgcaaacggccaag
gacctgcaagcagaaggcaagccactgacagaacatcctgcgtttgccgtcatcgacttg
ctgctcaatgagttcaagcgtccgggcaaggctgccggtggaggtttctacgagtatccg
gtgggcggccagaaatacctgtggccggagttgaaaaaacgcttcgagaaagccgacggg
cagatttcgccagtggatgtgcgcgatcgcttgctgttcgtgcaagccatcgaaaccgtg
cgttgtgtggaggagggcgtgttgacctcgacggcggacgccaacgtcggctcgatcttc
ggcatcggtttcgccgcctggactggcggtgcactgcagttcatcaaccagtacggcgta
caggactttgtcgcccgcgcccagtacctggccaagcaatatggcgaacggttcgcgccg
cctgcactgctactggaaaaagcggcaaaaggggaggccttctaa

DBGET integrated database retrieval system