KEGG   Pseudomonas sp. UW4: PputUW4_03698Help
Entry
PputUW4_03698     CDS       T02357                                 

Gene name
mtnD
Definition
acireductone dioxygenase (EC:1.13.11.54 1.13.11.53)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PputUW4_03698 (mtnD)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PputUW4_03698 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PputUW4_03698 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4291727..4292272)
Genome map
AA seq 181 aa AA seqDB search
MSSLSVYHVSSPEIPNKVLTHFEDIASTLAEQGVRFDRWQAATRLQPGATQEEVIAAYQE
QIDQLMTERGYITVDVISLNSDHPQKAELRAKFLNEHRHGEDEVRFFVAGRGLFTLHIDD
YVYAVLCEKNDLISVPAGTRHWFDMGEHPHFIAIRLFNNPEGWVANFTGEDIASQFPRLE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgtccgtttatcacgtctccagccctgaaatccccaacaaggtgctgacc
catttcgaagacatcgcctcgaccctggctgaacaaggcgtgcgcttcgaccgctggcaa
gccgccaccaggcttcagccgggcgccactcaggaagaagtgattgccgcctatcaagag
caaatcgaccagctgatgaccgagcgcggttacatcacagtcgatgtgatcagcctcaac
agcgatcacccgcaaaaagccgaactgcgcgccaagttcctcaatgaacaccgccatggc
gaggacgaagtacgatttttcgttgccggccgtggtctgtttaccctgcacatcgacgat
tacgtctacgccgtgctgtgcgagaaaaacgatctgatctcggtgccggccggtaccaga
cactggttcgacatgggcgagcacccgcatttcattgcgatccgcctgttcaacaacccg
gaaggctgggtggccaatttcaccggtgaagacatcgccagccaattcccgcgtctggag
gactga

DBGET integrated database retrieval system