KEGG   Pseudomonas sp. UW4: PputUW4_03804Help
Entry
PputUW4_03804     CDS       T02357                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00020  Citrate cycle (TCA cycle)
ppuu00190  Oxidative phosphorylation
ppuu00650  Butanoate metabolism
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
ppuu01200  Carbon metabolism
Module
ppuu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppuu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppuu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputUW4_03804 (sdhD)
   00650 Butanoate metabolism
    PputUW4_03804 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PputUW4_03804 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFY20996
UniProt: K9NLQ2
Position
complement(4400330..4400698)
Genome map
AA seq 122 aa AA seqDB search
MVTSVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYLAANPGIGYDQWHGLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagcgttacgaacctttcgcgttccggtctttatgactggatggcgcaacgt
gtgtctgcggtcgttctcgcggcttatttcatcttcctgatcggatacctcgcagcgaac
ccgggcattggctacgaccaatggcacggcctgttcgcccacaacgggatgcgtatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtccgcaactgcagtacgtttccttttc
caggcagtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system