KEGG   Pseudomonas sp. UW4: PputUW4_03854Help
Entry
PputUW4_03854     CDS       T02357                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputUW4_03854 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PputUW4_03854 (cheB)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputUW4_03854 (cheB)
Two-component system [BR:ppuu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PputUW4_03854 (cheB)
Bacterial motility proteins [BR:ppuu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PputUW4_03854 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4447072..4448202)
Genome map
AA seq 376 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADSNIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKILSISRSNRRVSHYSAPAPVAAPTPTPAPSSVGSFASSAPARPAPAPIPARTHAP
ASSSPAPKRKNYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLVQHMPAAFTKAFAERL
DKLCRISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITFGS
AAKSYGDKVLAVVLTGMGADGREGARLLKQGGSSIWAQDEASCVIYGMPMAIVKAELADA
VYSLDDIGKHLVEACI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggtttttccgccgccgcgtctcggaa
attctttcagcggattcgaatatccaggtcgtcggcacggcgaccaacggcaaagaggcg
atcgatcaggcgctggccctcaagcccgacgtgatcaccatggactacgagatgccgatg
atggacggcatcactgccgtgcggcacatcatgcaacgctgcccgaccccggtcttgatg
ttctcctcactgacccatgaaggcgcccgggtcaccctcgatgcgctggatgccggtgcg
gtggacttcctgccgaagaatttcgaagacatctcgcgcaaccccgagaaggtcaagcaa
ctgctgtgcgagaagatcctgagcatctcgcgcagtaatcgtcgtgtcagtcactacagc
gctccggcgcctgtcgctgcgccaactccgacgccggcgccttccagcgtgggcagtttt
gccagcagcgcgcccgcgcgtccggcaccggcaccgatcccggcgcgtacgcatgcaccc
gcttcgtcgtcgcccgcgccaaaacgcaaaaactacaaactggtggccatcggtacgtcc
accggcggcccggtggccctgcagcgggtcttgacccaattgccggccaacttcccggcc
ccgatcgtgctggttcaacacatgccggccgccttcaccaaggccttcgccgagcgcctg
gacaagctctgccgcatcagcgtcaaggaagccgaggatggtgacatcctgcgtccgggc
ctggcgttgctggcgccgggtggcaagcagatgatgatcgacggtcgcggcgcggtgaaa
atcctcccgggtgacgagcgtctgaattacaagccgtgcgtggacatcaccttcggttcg
gcagccaagtcctacggtgacaaagttctggcggtcgtcctgaccggcatgggcgccgat
ggccgcgaaggcgcgcgcctgctcaagcagggcggcagttcgatctgggcgcaggacgaa
gccagttgcgtgatctacggcatgccgatggccattgtaaaagctgaactggccgacgcg
gtgtacagcctcgacgacattggcaagcacctggtcgaggcctgtatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system