KEGG   Pseudomonas sp. UW4: PputUW4_04261Help
Entry
PputUW4_04261     CDS       T02357                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputUW4_04261 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputUW4_04261 (glk)
   00052 Galactose metabolism
    PputUW4_04261 (glk)
   00500 Starch and sucrose metabolism
    PputUW4_04261 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PputUW4_04261 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputUW4_04261 (glk)
   00524 Butirosin and neomycin biosynthesis
    PputUW4_04261 (glk)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PputUW4_04261 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4892654..4893613)
Genome map
AA seq 319 aa AA seqDB search
MKLALVGDIGGTNARFALWKNQQLESVQVLATADFPSPEEAISLYLNGLGLARGSIGSVC
LSVAGPVSGDEFKFTNNHWRLSRKGFCQTLQVDRLLLVNDFSAMALGMTRLQPGEFRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPLSSPRETQLWQHIFN
EIGHVSAETALSGGGLPRVYRAICAVDGHTPVLDTPEAITAAGLAGDPIAVEVLEQFCCW
LGRVAGNNVLTSGGRGGVYIVGGVIPRFADFFLESGFARCFADKGCMSDYFKGIPVWLVT
APYSGLMGAGVALEQSNPA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactggctttggtcggtgacatcggtgggaccaacgcacgtttcgcgttgtggaaa
aaccagcagctggaatcggtccaggtgctggcaacggcggatttccccagcccggaagag
gcgatcagcctctacctcaacggtctggggctggcgcggggttcgatcggttcggtgtgc
ctgtcggtggccggtcccgtcagtggtgatgagttcaagttcaccaacaatcactggcgt
ctgagccgcaagggtttctgccagaccttgcaggtggatcgactgttgctggtcaacgac
ttctcggccatggccctgggcatgacccgtttgcagcccggcgaattccgcgtggtctgc
gaaggcacgccggagccattgcgcccggccgtggtgattggcccgggcacaggcctgggc
gtcggcaccttgctggatctgggcgagggccggtttgctgcgttgccaggggagggcggt
cacgtcgacttgcctttgagcagcccgcgtgaaacccaactctggcagcacatcttcaac
gagatcggccatgtcagtgctgaaaccgcgttgagcggcggcggcttgccccgcgtctac
cgggcgatctgtgcggtggacggacacacgccggtgctcgacacgccggaagccatcacc
gccgccgggctggcgggcgacccgattgccgtggaagtgcttgagcaattctgctgctgg
ctcggtcgcgtggcgggcaacaacgtgctgaccagcggtgggcgcggtggcgtgtacatc
gttggcggagtgattccacggtttgccgatttcttcctcgaaagcggtttcgcccgctgc
ttcgccgacaagggttgcatgagcgattacttcaagggaattccggtgtggctggtgacg
gcgccgtattcgggcttgatgggtgcgggtgtggccttggaacaatcaaacccagcttga

DBGET integrated database retrieval system