KEGG   Pseudomonas sp. UW4: PputUW4_04416Help
Entry
PputUW4_04416     CDS       T02357                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PputUW4_04416 (glpK)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PputUW4_04416 (glpK)
Exosome [BR:ppuu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputUW4_04416 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5067712..5069217
Genome map
AA seq 501 aa AA seqDB search
MTDTQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKNTGRPIYNAIVWQCRRSTEICQQLK
RDGHEQYISDTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KVHVTDYTNASRTMLFNIHTLEWDAKMLELLDIPREMLPQVKSSSEIYGHTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGDKAVKSKHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIINDAHDTEYFANKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPQMRETTALGAAYLAGLACGFWGSLEELRGKAVIERRFEPTLDEAAKEKL
YAGWKKAVSRTRDWAVEDEAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacacagaataagaactacatcattgccctcgatcagggtacgaccagctcc
cgcgcgatcattttcgaccgcgacgcgaacgtggtctgcaccgcccaacgggagttcgcc
cagcattacccgcaagccggttgggtcgagcatgacccgatggagatcttcgccacccaa
agcgccgtgatggtcgaggccctggcacaagccggcctgcaccacgaccaggtagccgcc
atcggcatcaccaaccagcgcgaaaccaccgtggtgtgggacaagaacaccggtcgcccg
atctacaacgccatcgtctggcagtgccggcgcagcaccgagatctgccagcagctcaag
cgcgatggccacgagcaatacatcagcgacaccaccggcctggtcaccgacccctacttc
tccggcaccaagctgaagtggatcctcgacaacgtcgaaggcagccgcgaacgtgcgcgc
aacggcgaactgctattcggcaccgtcgacagctggctgatctggaaatttaccggcggc
aaggtgcacgtcaccgactacaccaacgcctcgcgcaccatgctcttcaacatccacacc
ctggagtgggacgcgaagatgctggagctgctggatatcccgcgcgaaatgctcccgcaa
gtcaaatcgtcctcggaaatctacggccataccaaaagcggcatcgccatcggcggtatc
gccggtgaccagcaagccgctctgttcggccagatgtgcgtcgagccaggccaggcaaaa
aacacctacggcactggctgcttcctgctgatgaacaccggtgacaaagcggtgaaatcc
aagcatggcatgctgaccaccatcgcttgcggccctcgcggcgaagtggcctacgcgctg
gaaggcgcggtgttcaacggtggctccaccgtgcagtggctgcgtgacgaacttaaaatc
atcaatgacgcccacgacaccgaatactttgccaacaaggtcaaggacagcaacggcgtg
tacctggtgccggccttcaccggacttggcgcaccgtactgggacccgtacgcccgtggc
gcattgttcggcctgacccgcggcgtacgcgtggaccacatcattcgcgccgcgctggag
tcgattgcctaccagacccgcgacgtgctggacgccatgcagcaggactccggcgaacgt
ctcaaggccctgcgcgtggacggtggcgcggtggccaacaatttcctcatgcagttccag
gccgacatcctcggcacgcaggtcgagcgcccgcaaatgcgcgaaaccacagcactcggc
gccgcttacctggcaggcctggcctgtggcttctggggcagcctggaagagttgcgtggc
aaggccgtgattgagcgccggttcgagccgacgctggatgaagcggcgaaggaaaaactc
tacgccggctggaaaaaagcggtcagccgcacccgcgattgggcggttgaagacgaggct
gaataa

DBGET integrated database retrieval system