KEGG   Pseudomonas sp. UW4: PputUW4_04426Help
Entry
PputUW4_04426     CDS       T02357                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PputUW4_04426 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputUW4_04426 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PputUW4_04426 (thrC)
Enzymes [BR:ppuu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PputUW4_04426 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5080036..5081445)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFAHSAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLEKRGERVVIVGATSGDTGSAAIEGCKHCENVDIFILHPHNRVSEVQRRQMTTI
FGENIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGAAIAGLMDSFKQGGGFSVEQERWTEARKLFDS
LAVDDVQTCETIAEVYEQTGEVLDPHTAIGVKAARECRRSLDIPMVILGTAHPVKFPDAV
EKAGVGKALELPVHLSDLFERDERCTVLPNDLKAVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagtacccgcggccaggcaccggccctgaatttcgaagacgtcctgctg
gcaggccttgccaccgacggcggtctgtacgtcccggaaaacctgccacgcttcacccag
gaggaaatcgcgtcctgggccggcctgccgtatcacgagctggccttccgcgtcatgcgc
ccgtttgtcaccggcagcattccggacgccgatttcaaaaagatccttgaagaaacctac
ggcgtgttcgcccacagcgccgtcgcgccactgcgtcagctgaacggtaacgaatgggtg
ctggagctgttccacggcccgaccctggcgttcaaggacttcgccctgcaactgctcggt
cgtttgctcgactacgtgctggaaaagcgcggcgagcgcgtggtgatcgtcggcgctacc
tccggtgacaccggttcggccgccatcgaaggctgcaagcactgcgaaaacgtcgacatc
ttcatcctgcacccgcacaaccgcgtgtccgaggtgcaacgtcggcagatgaccaccatc
ttcggtgagaacatccacaacattgccatcgaaggcaacttcgatgactgccaggaaatg
gtcaaggccagctttgccgaccagggcttcctcaagggcactcgcctggtcgccgtgaac
tcgatcaactgggcgcggatcatggcccagatcgtttactacttccatgcggccctgcaa
ctgggcggcccggcgcgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggttacctggcacgcaacatgggcctgccgatcaaccagttgatcgtcgccacc
aaccgcaacgatatcctgcaccgcttcatgagcggtaaccagtacgtcaaggaaaccctg
cacgccacgctgtcgccgtccatggacatcatggtgtcgtcgaacttcgagcgcctgctg
ttcgacctgcatggccgcaacggcgcggctatcgccggactgatggattcattcaagcag
ggcggtggtttcagcgtcgagcaagagcgctggaccgaagcccgcaagttgttcgactcg
ttggccgtggatgacgtgcaaacctgcgaaaccatcgccgaagtctacgagcagaccggt
gaggtgctggacccgcacactgccatcggggtgaaagctgcacgcgaatgtcgtcgtagc
ctggacattccaatggtgatcctgggtaccgcccacccggtcaaattcccggacgccgtg
gaaaaagccggtgtaggaaaagctctcgaactgcctgtacatctttctgatttgtttgag
cgagacgaacgttgcaccgtattgccaaatgacctgaaggccgtgcaggcctttgtcagc
cagcatggcaatcgtggcaagccgctgtaa

DBGET integrated database retrieval system