KEGG   Pseudomonas sp. UW4: PputUW4_04428Help
Entry
PputUW4_04428     CDS       T02357                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppuu  Pseudomonas sp. UW4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5082950..5083681)
Genome map
AA seq 243 aa AA seqDB search
MRLTQIFAAAAIALVSTFAVADDAADKAIRKSLENLQLEVPVETITASPMPGLYEVKLKG
SRVLYASADGQYVVQGYLFDLKDGKPVNLTEKTERLGISKLINDIPVAETVVYPAIGETK
SHITVFTDTTCPYCHKLHAEVPELNKRGIEVRYVAFPRQGLGSPGDEQLQAVWCSKDKKA
AMDKMVDGKEIKAAKCDNPVSKQYALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgacccagattttcgccgccgcagccattgcgttggtcagcacctttgccgtc
gccgatgacgcggccgacaaagccattcgtaaaagcctggaaaacctccagctcgaagtg
ccggtagagactatcaccgccagcccgatgcccggtctgtacgaagtcaagctcaagggc
agccgtgtgctgtacgccagcgccgacggccagtacgtggtgcagggctacctgtttgat
ctcaaggacggcaagccggtcaacctgaccgagaagaccgagcgcctgggcatctccaag
ctgatcaacgatattccggttgcagaaaccgtggtgtacccggccattggcgaaaccaag
tcgcacatcaccgtattcaccgatacaacctgcccgtactgccacaaactccacgccgaa
gtgccggagctgaacaagcgcggcatcgaagtgcgttatgtcgcattccctcgccagggc
ctgggctcgccgggtgacgagcaactgcaagccgtgtggtgctcgaaagacaagaaagcg
gccatggacaaaatggtcgacggcaaggaaatcaaggccgccaagtgcgataacccggtt
tccaaacagtacgcactcggccagtcgatcggcgtgaacggcacaccggccatcgttttg
gccgacggacaggtcattccgggctaccagcctgcgccacaagtcgccaaactggcgctg
ggcgcgaagtaa

DBGET integrated database retrieval system