KEGG   Pseudomonas sp. UW4: PputUW4_04630Help
Entry
PputUW4_04630     CDS       T02357                                 

Gene name
folK1
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppuu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5312033..5312518
Genome map
AA seq 161 aa AA seqDB search
MERIYIGMGSNLADPAEQLRSAAEALAYLPRSRLVGVSAFYQSDSLLPGQPRYTNAVAAL
ESTLAPLELLDALQAIENGQGRERLERWGPRTLDLDILLFGDRLIDEPRLKVPHYHMQER
AFVLYPLAELAPADLQLADGRTLAELLKACPFVGLERLPQN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcatctacatcggcatgggcagcaatctggctgaccccgccgaacaattgcgc
agcgccgccgaggcgctggcgtacttgccgcgatcccgactggtcggggtttctgcgttt
tatcaaagcgactcactgcttcccggacaaccgcgctacaccaatgcggtggccgcgctc
gaaagcacgctggctccactggaattgctggatgccttgcaggccatcgaaaacggccag
ggtcgcgagcgccttgaacgctggggaccgcgaacactggacctcgacatcttgctgttc
ggtgatcgcctgatcgacgaaccgcgcctcaaggttccccactaccacatgcaggaacgg
gccttcgtgctttacccgctggcggaactggcacctgcggatttgcaactcgccgatggc
cgaaccctggccgaactgctcaaggcatgcccgttcgtcggcctggaacgcctgccccaa
aattga

DBGET integrated database retrieval system