KEGG   Pseudomonas sp. UW4: PputUW4_04673Help
Entry
PputUW4_04673     CDS       T02357                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00330  Arginine and proline metabolism
ppuu00332  Carbapenem biosynthesis
ppuu01100  Metabolic pathways
ppuu01130  Biosynthesis of antibiotics
ppuu01230  Biosynthesis of amino acids
Module
ppuu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PputUW4_04673 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PputUW4_04673 (proB)
Enzymes [BR:ppuu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PputUW4_04673 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFY21864
UniProt: K9NQ48
Position
complement(5354916..5356037)
Genome map
AA seq 373 aa AA seqDB search
MMRSKVTGAQRWVVKIGSALLTADGKGLDRAAMGVWVEQMVALHEAGVELVLVSSGAVAA
GMSRLGWTSRPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYL
NARSTLRALVELKVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMF
DADPRNNPDAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVG
GRLERVLDRLKAGERIGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVTALSEGNKS
LLPVGVKLVQGSFRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSEAIVGLLGYMA
EPELVHRDNLILV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggagcaaggtgacaggtgcgcagcgttgggtcgtgaagatcggcagcgctttg
ctgacggcggacggcaagggcctggatcgcgcggcaatgggtgtctgggttgagcagatg
gtggccttgcatgaggcgggtgtcgagctggtgctggtgtcctccggggcggtggcggcc
ggtatgagccgcttgggctggacttcgcgacccagtgcgatgcacgagcttcaggccgct
gctgcaatcggccagatggggctggtgcaggcctgggagtcgagctttgccgagcacggt
cggcatactgcgcagattctcctgactcacgacgacctgtccgaccgcaagcgctacctg
aacgcccgcagtaccttgcgcgcattggtcgagctcaaggttattccggtcatcaacgag
aatgacaccgtggttaccgacgaaatccgtttcggcgataacgacaccctggcggcgctg
gtggcgaacctggtcgaggcggatttgctggtgatcctgacggatcgcgatggcatgttc
gacgctgatccgcgcaacaatccggatgcccagctgatttacgaagcgcgtgccgatgat
ccggcgctcgatgcggtggcgggcggtacgggcggggcgctggggcgtggtggtatgcag
accaagctgcgtgcggcgcgtctggcggcccgttccggcgctcacaccattatcgtgggt
gggcggcttgagcgtgtgctggatcgcctcaaggcgggcgaacgtatcggtaccctgctg
tcgccggagcgtggcatgctggcggcgcgcaagcagtggctggccggtcatctgcaaacc
cgtggcaccctggtgctggatgccggtgcggtgactgcgttgtccgagggcaacaagagc
ttgctgccggttggggtcaaattggtgcagggcagcttccgtcgcggcgagatggtcgtc
tgcgtggcgccggacggtcgtgagattgcccgcggcctggccaactacagtgcgctggaa
gcgcaaaaaatcatcggtcagtcgtccgaggcgattgtcggtctgctgggttacatggcg
gaaccggaactggttcatcgcgataacctgatcctggtctga

DBGET integrated database retrieval system