KEGG   Pseudomonas sp. UW4: PputUW4_05111Help
Entry
PputUW4_05111     CDS       T02357                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppuu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppuu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5835108..5836127
Genome map
AA seq 339 aa AA seqDB search
MTPLDTKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGGFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGIEQYGVKVYTDMTEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQFEQGQFEQESAQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctctagacaccaagcgcccgctgcagctcaatgatcagggccagctgcgccac
ttcctctcgctcgacggtttgcgccgtgagctgttgacggaaatcctcgacaccgccgac
tccttcctcgaagtcggcgcccgggccgtgaagaaagtcccgttgctgcgcggcaagacc
gtgtgcaatgtgttcttcgagaactcgacccgtacccgcaccaccttcgaactggcggcc
cagcggctctcggcggacgtgatcaccctcaacgtgtccacgtcgtcggcaagcaagggc
gagaccctgctcgacaccctgcgtaacctggaagccatggccgccgacatgttcgtcgtg
cgccacggtgactccggcgccgcgcacttcatcgccgagcatgtctgcccgcaagtggcg
atcatcaacggcggtgacggccggcacgcgcacccgacccagggcatgctcgacatgctg
accattcgccggcacaagggcgggttcgaaaacctttcggtggccatcgtcggcgacatc
ctgcactcgcgggtggcgcgctcgaacatgctggccctgaaaaccctcggttgcccggac
atccgcgtgatcgcaccgaagaccctgctgccgatcggcatcgagcaatacggcgtgaag
gtctacaccgacatgaccgaaggcctgaaggacgtcgacgtggtgatcatgttgcgtctg
cagcgtgaacgcatgaccggcggcctgctgccgagcgaaggcgagttctaccgcctgttc
ggcctgaccaccgcgcgcctggccggcgccaaacccgatgccatcgtgatgcacccgggg
ccgatcaaccgcggcgtggaaatcgagtcggcagtggccgacggtccgcattcggtgatc
ctcaaccaggtgacctacgggatcgccattcgtatggccgtgctgtccatggccatgagc
gggcagactgcgcagcgtcaattcgagcagggccaattcgaacaggagagcgcacagtga

DBGET integrated database retrieval system