KEGG   Pseudomonas sp. UW4: PputUW4_05326Help
Entry
PputUW4_05326     CDS       T02357                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00010  Glycolysis / Gluconeogenesis
ppuu00030  Pentose phosphate pathway
ppuu00051  Fructose and mannose metabolism
ppuu00052  Galactose metabolism
ppuu00230  Purine metabolism
ppuu00500  Starch and sucrose metabolism
ppuu00520  Amino sugar and nucleotide sugar metabolism
ppuu00521  Streptomycin biosynthesis
ppuu01100  Metabolic pathways
ppuu01110  Biosynthesis of secondary metabolites
ppuu01120  Microbial metabolism in diverse environments
ppuu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputUW4_05326 (algC)
   00030 Pentose phosphate pathway
    PputUW4_05326 (algC)
   00051 Fructose and mannose metabolism
    PputUW4_05326 (algC)
   00052 Galactose metabolism
    PputUW4_05326 (algC)
   00500 Starch and sucrose metabolism
    PputUW4_05326 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PputUW4_05326 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PputUW4_05326 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputUW4_05326 (algC)
Enzymes [BR:ppuu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PputUW4_05326 (algC)
    5.4.2.8  phosphomannomutase
     PputUW4_05326 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AFY22515
UniProt: K9NT62
Position
6054645..6056042
Genome map
AA seq 465 aa AA seqDB search
MNTPAKIAPKFPDSIFRAYDIRGTVPEFLNAETAYWIGRAVGSQSLAQGEPNVSVGRDGR
LSGPELVAQLIKGIADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHDRLKTNNLSSGQGSITQVEILDRYTTEIVQDIKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETNADIG
LAFDGDGDRVGVVTNTGSIVYPDRLLMLFARDVVARNPGAEIIFDVKCTRRLIPLIKEYG
GRSLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
SAEELFSTFPNDISTPEINIHVTEESKFSIIDALHDAQWGAGADLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADDEAELQRIKDVFKVQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccggccaaaattgcacccaagttccctgacagcatcttccgcgcctacgac
atccgcggcaccgtcccggaattcctgaacgccgagaccgcttactggattggccgcgcc
gtcggctcccaaagcctggcccagggcgagccaaatgtgtccgtcggtcgcgacggtcgc
ttgtccggcccggagctggtcgcgcaattgatcaaaggcatcgccgacagcggctgccac
gtcagcgatgtcggcctggtcccgacgccggcgctgtactacgccgccaacgtgctggcc
ggcaaatccggtgtgatgctcaccggcagccacaacccgtcgaactacaacggcttcaag
atcgtcattgccggcgacacactggccaacgaacagatccaggccctgcacgaccgcctc
aagaccaacaacctgagcagcggccagggcagcatcacccaggtcgaaatcctcgaccgc
tacaccaccgaaatcgtccaggacatcaagctggcccgtcgcctgaaagtggtcgtcgat
tgcggcaacggcgcggccggcgtgattgccccgcagctgatcgaagcgctgaactgcgaa
gtcatcccgctgttctgcgaagtcgacggcaacttcccgaaccaccacccggacccgggc
aagcctgaaaacctcgtcgacctgatcgccaaggtcaaggaaaccaacgctgacatcggc
ctggccttcgacggcgacggagaccgcgtcggcgtggtgaccaacaccggcagtatcgtc
tatccggaccgcctgctgatgctgttcgcccgcgacgtcgtagcgcgtaacccgggcgcc
gagatcattttcgacgtcaaatgcacccgacgcctgatcccgctgatcaaggaatacggc
ggccggtcgttaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaacaatcc
ggcgccttgctggccggcgaaatgagcgggcacatcttcttcaaggagcgctggttcggt
ttcgacgacggcatttacagcgccgcgcggttgctggagatcctcagcaaggaaaaatcc
tcggccgaagagctgttttcgaccttcccgaacgatatttctacgccggagatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgacgcacagtggggc
gcaggcgccgacctgaccaccattgacggcgtgcgagtcgactacgccaaaggctggggc
ctggtacgcgcatccaacaccacaccggtgctggtgctgcgtttcgaggccgatgacgag
gctgaattgcagcgcatcaaggacgttttcaaagtccagttgaagcgcgttgcacctgat
ctccaactaccgttctga

DBGET integrated database retrieval system