KEGG   Pseudomonas sp. UW4: PputUW4_05326Help
Entry
PputUW4_05326     CDS       T02357                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputUW4_05326 (algC)
   00030 Pentose phosphate pathway
    PputUW4_05326 (algC)
   00051 Fructose and mannose metabolism
    PputUW4_05326 (algC)
   00052 Galactose metabolism
    PputUW4_05326 (algC)
   00500 Starch and sucrose metabolism
    PputUW4_05326 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PputUW4_05326 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PputUW4_05326 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputUW4_05326 (algC)
Enzymes [BR:ppuu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PputUW4_05326 (algC)
    5.4.2.8  phosphomannomutase
     PputUW4_05326 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6054645..6056042
Genome map
AA seq 465 aa AA seqDB search
MNTPAKIAPKFPDSIFRAYDIRGTVPEFLNAETAYWIGRAVGSQSLAQGEPNVSVGRDGR
LSGPELVAQLIKGIADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHDRLKTNNLSSGQGSITQVEILDRYTTEIVQDIKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETNADIG
LAFDGDGDRVGVVTNTGSIVYPDRLLMLFARDVVARNPGAEIIFDVKCTRRLIPLIKEYG
GRSLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
SAEELFSTFPNDISTPEINIHVTEESKFSIIDALHDAQWGAGADLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADDEAELQRIKDVFKVQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccggccaaaattgcacccaagttccctgacagcatcttccgcgcctacgac
atccgcggcaccgtcccggaattcctgaacgccgagaccgcttactggattggccgcgcc
gtcggctcccaaagcctggcccagggcgagccaaatgtgtccgtcggtcgcgacggtcgc
ttgtccggcccggagctggtcgcgcaattgatcaaaggcatcgccgacagcggctgccac
gtcagcgatgtcggcctggtcccgacgccggcgctgtactacgccgccaacgtgctggcc
ggcaaatccggtgtgatgctcaccggcagccacaacccgtcgaactacaacggcttcaag
atcgtcattgccggcgacacactggccaacgaacagatccaggccctgcacgaccgcctc
aagaccaacaacctgagcagcggccagggcagcatcacccaggtcgaaatcctcgaccgc
tacaccaccgaaatcgtccaggacatcaagctggcccgtcgcctgaaagtggtcgtcgat
tgcggcaacggcgcggccggcgtgattgccccgcagctgatcgaagcgctgaactgcgaa
gtcatcccgctgttctgcgaagtcgacggcaacttcccgaaccaccacccggacccgggc
aagcctgaaaacctcgtcgacctgatcgccaaggtcaaggaaaccaacgctgacatcggc
ctggccttcgacggcgacggagaccgcgtcggcgtggtgaccaacaccggcagtatcgtc
tatccggaccgcctgctgatgctgttcgcccgcgacgtcgtagcgcgtaacccgggcgcc
gagatcattttcgacgtcaaatgcacccgacgcctgatcccgctgatcaaggaatacggc
ggccggtcgttaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaacaatcc
ggcgccttgctggccggcgaaatgagcgggcacatcttcttcaaggagcgctggttcggt
ttcgacgacggcatttacagcgccgcgcggttgctggagatcctcagcaaggaaaaatcc
tcggccgaagagctgttttcgaccttcccgaacgatatttctacgccggagatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgacgcacagtggggc
gcaggcgccgacctgaccaccattgacggcgtgcgagtcgactacgccaaaggctggggc
ctggtacgcgcatccaacaccacaccggtgctggtgctgcgtttcgaggccgatgacgag
gctgaattgcagcgcatcaaggacgttttcaaagtccagttgaagcgcgttgcacctgat
ctccaactaccgttctga

DBGET integrated database retrieval system