KEGG   Pseudomonas sp. UW4: PputUW4_05367Help
Entry
PputUW4_05367     CDS       T02357                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppuu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6097638..6098537
Genome map
AA seq 299 aa AA seqDB search
MSTPNVEAVKLDELNCWRIRHGQAELLVAQQGAHILSYQLAGQPPLIWLNDEAVFKTGKG
IRAGVPVCWPWFGNFARNPQSVQAMRISNEAPSAHGFVRAMDWELGGIEAEGESLKVEFL
LPYPEGGFPGWPHQVDLTMTIRLDEQLHIQLTSHNRGTDTVSISQALHSYFAVSDVRDVR
VEGVDGLNYIETLDNWKTVTQTGDLHFTGETDRIYLDAPPQLSIVDPAWERRIVLTSSGS
RTAVIWNPWIDRAAAFSDMADDGWQRMLCIETANVLGDVVTLAAGASHTLGVSIGSAPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccaatgttgaagccgtaaaactggatgaactgaactgctggcgcatccgc
cacggtcaagccgaattactggtggcccagcaaggtgcgcacatcctcagctatcagctg
gccggccagccgccgctgatctggctcaacgacgaggccgtattcaagaccggcaagggc
atccgcgccggcgtaccggtgtgctggccgtggttcggtaactttgcgcgcaacccgcaa
agcgtgcaggcgatgcgcatcagtaatgaagcgccatcggctcacggcttcgtgcgagcg
atggattgggaactgggtggcatcgaagccgaaggcgaaagtctgaaggtcgaattcctc
ctgccctaccccgaaggcggctttcccggctggccgcaccaggtggatttgactatgacc
attcgcctcgatgagcaattgcacatccagctgaccagccacaaccggggcactgatacc
gtcagcatcagccaggcgctgcacagctactttgccgtcagcgatgtgcgtgatgtgcgc
gtcgaaggtgtggacggcctcaactacatcgaaaccctggataactggaaaaccgtcacc
cagaccggtgatctgcattttaccggcgagaccgaccgcatctacctcgacgccccgcca
cagttgagcatcgtcgatccagcctgggaacggcgcatcgtactgaccagcagcggatcg
cgcacggcagtgatctggaacccgtggatcgaccgcgccgctgcgttcagcgacatggcc
gacgacggctggcagcgcatgttgtgcatcgagacggcgaacgtgttgggtgatgtggtg
acgctcgcagcaggtgctagccacaccttgggtgtcagcatcggtagcgcgccgctctaa

DBGET integrated database retrieval system